Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NV29

Protein Details
Accession J3NV29    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MDLDSQKPRKKGKKPKFNAKSPKNFRVIKHydrophilic
NLS Segment(s)
PositionSequence
7-47KPRKKGKKPKFNAKSPKNFRVIKPRKLGKPLNKSIKKLIPK
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MDLDSQKPRKKGKKPKFNAKSPKNFRVIKPRKLGKPLNKSIKKLIPKDITLLKKGLFKQKIRCLSLFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.92
3 0.92
4 0.92
5 0.92
6 0.91
7 0.91
8 0.89
9 0.86
10 0.83
11 0.77
12 0.71
13 0.71
14 0.7
15 0.67
16 0.67
17 0.67
18 0.64
19 0.67
20 0.71
21 0.69
22 0.71
23 0.71
24 0.73
25 0.71
26 0.69
27 0.68
28 0.67
29 0.65
30 0.59
31 0.59
32 0.54
33 0.49
34 0.51
35 0.53
36 0.49
37 0.44
38 0.42
39 0.35
40 0.36
41 0.39
42 0.45
43 0.45
44 0.48
45 0.55
46 0.63
47 0.7
48 0.7