Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5Z4D4

Protein Details
Accession A0A2C5Z4D4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
36-59TPKNKFNTYKDEKQKKKEKDKGSLBasic
NLS Segment(s)
PositionSequence
49-54QKKKEK
Subcellular Location(s) cyto_nucl 15.333, cyto 13, nucl 11.5, mito_nucl 7.998
Family & Domain DBs
Amino Acid Sequences MEAAAGPLISSPVRNMDQCKSPQREIAQEPNKTKETPKNKFNTYKDEKQKKKEKDKGSLLVLSAAKSRSPQLSPLTKIPGQKITDDEQTDSRCLGAAVHPGCVAGDVECLGLTHRLGTLPVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.23
3 0.26
4 0.33
5 0.39
6 0.48
7 0.49
8 0.49
9 0.52
10 0.52
11 0.54
12 0.53
13 0.57
14 0.56
15 0.56
16 0.57
17 0.57
18 0.56
19 0.5
20 0.49
21 0.48
22 0.5
23 0.51
24 0.56
25 0.57
26 0.62
27 0.7
28 0.69
29 0.7
30 0.67
31 0.69
32 0.71
33 0.75
34 0.75
35 0.75
36 0.81
37 0.81
38 0.84
39 0.83
40 0.8
41 0.79
42 0.79
43 0.74
44 0.67
45 0.59
46 0.48
47 0.42
48 0.35
49 0.26
50 0.2
51 0.15
52 0.12
53 0.12
54 0.13
55 0.12
56 0.12
57 0.16
58 0.2
59 0.25
60 0.28
61 0.3
62 0.34
63 0.34
64 0.36
65 0.35
66 0.36
67 0.32
68 0.3
69 0.31
70 0.29
71 0.32
72 0.31
73 0.3
74 0.27
75 0.28
76 0.27
77 0.24
78 0.2
79 0.15
80 0.13
81 0.12
82 0.1
83 0.16
84 0.16
85 0.17
86 0.17
87 0.16
88 0.16
89 0.16
90 0.14
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.08
98 0.09
99 0.09
100 0.09
101 0.09
102 0.1