Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5ZBT1

Protein Details
Accession A0A2C5ZBT1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
40-60ASAPRRTKHKTVEQARSRQSNHydrophilic
NLS Segment(s)
PositionSequence
30-48RSSPPRAPVRASAPRRTKH
Subcellular Location(s) mito 22.5, cyto_mito 13.833, mito_nucl 12.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR003782  SCO1/SenC  
IPR017276  Synth_of_cyt-c-oxidase_Sco1/2  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0016531  F:copper chaperone activity  
GO:0005507  F:copper ion binding  
GO:0006878  P:intracellular copper ion homeostasis  
GO:0008535  P:respiratory chain complex IV assembly  
Pfam View protein in Pfam  
PF02630  SCO1-SenC  
CDD cd02968  SCO  
Amino Acid Sequences MTRPAAAKVAGRLFCRRCFSSSFFQLPRPRSSPPRAPVRASAPRRTKHKTVEQARSRQSNGPFSWKSGVLFVITCAALVWYFESEKARMQRKRIADASKGVGKPKVGGGFELIDQDGKLFTSAMMKGKHSLVYFGFTRCPDICPDELDKMARMIDLVEDKAPGSLLPIFITCDPARDDSKALKSYLAEFHPAIIGLTGTYDQIKDVCKKYRVYFSTPQEVKAGQDYLVDHSIYFYLMDPQGDFVEALGRQHSPGEASKLILDHIKDWKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.51
4 0.47
5 0.48
6 0.51
7 0.51
8 0.55
9 0.56
10 0.52
11 0.57
12 0.62
13 0.61
14 0.62
15 0.56
16 0.55
17 0.55
18 0.61
19 0.63
20 0.63
21 0.69
22 0.66
23 0.66
24 0.65
25 0.66
26 0.68
27 0.65
28 0.67
29 0.65
30 0.67
31 0.72
32 0.73
33 0.72
34 0.7
35 0.74
36 0.74
37 0.75
38 0.79
39 0.8
40 0.81
41 0.81
42 0.77
43 0.7
44 0.66
45 0.61
46 0.59
47 0.52
48 0.52
49 0.46
50 0.43
51 0.43
52 0.38
53 0.33
54 0.26
55 0.25
56 0.16
57 0.15
58 0.13
59 0.12
60 0.1
61 0.09
62 0.08
63 0.08
64 0.06
65 0.06
66 0.07
67 0.06
68 0.06
69 0.08
70 0.1
71 0.11
72 0.16
73 0.23
74 0.31
75 0.34
76 0.39
77 0.44
78 0.46
79 0.53
80 0.54
81 0.52
82 0.47
83 0.46
84 0.46
85 0.45
86 0.42
87 0.37
88 0.32
89 0.28
90 0.25
91 0.24
92 0.24
93 0.17
94 0.16
95 0.16
96 0.15
97 0.15
98 0.15
99 0.12
100 0.08
101 0.08
102 0.07
103 0.06
104 0.05
105 0.05
106 0.04
107 0.04
108 0.06
109 0.08
110 0.12
111 0.14
112 0.14
113 0.16
114 0.16
115 0.19
116 0.17
117 0.17
118 0.13
119 0.15
120 0.15
121 0.14
122 0.16
123 0.13
124 0.16
125 0.15
126 0.15
127 0.14
128 0.16
129 0.16
130 0.16
131 0.19
132 0.17
133 0.18
134 0.17
135 0.16
136 0.13
137 0.13
138 0.1
139 0.07
140 0.06
141 0.06
142 0.07
143 0.08
144 0.07
145 0.07
146 0.08
147 0.08
148 0.07
149 0.06
150 0.06
151 0.06
152 0.06
153 0.07
154 0.07
155 0.08
156 0.08
157 0.13
158 0.12
159 0.13
160 0.14
161 0.16
162 0.18
163 0.18
164 0.2
165 0.2
166 0.26
167 0.27
168 0.26
169 0.24
170 0.23
171 0.25
172 0.28
173 0.24
174 0.21
175 0.19
176 0.19
177 0.18
178 0.17
179 0.14
180 0.09
181 0.08
182 0.05
183 0.05
184 0.05
185 0.05
186 0.06
187 0.06
188 0.06
189 0.08
190 0.12
191 0.17
192 0.22
193 0.29
194 0.34
195 0.38
196 0.43
197 0.51
198 0.52
199 0.54
200 0.58
201 0.57
202 0.63
203 0.59
204 0.56
205 0.48
206 0.44
207 0.38
208 0.33
209 0.28
210 0.17
211 0.18
212 0.18
213 0.19
214 0.21
215 0.19
216 0.15
217 0.15
218 0.15
219 0.13
220 0.12
221 0.09
222 0.11
223 0.12
224 0.13
225 0.13
226 0.14
227 0.14
228 0.14
229 0.14
230 0.09
231 0.12
232 0.12
233 0.13
234 0.13
235 0.13
236 0.13
237 0.14
238 0.14
239 0.14
240 0.17
241 0.22
242 0.21
243 0.22
244 0.23
245 0.23
246 0.24
247 0.24
248 0.22
249 0.21