Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NY98

Protein Details
Accession J3NY98    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
58-81ASSARIKKNKKSNQVKFKVRCQTHHydrophilic
NLS Segment(s)
PositionSequence
62-68RIKKNKK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MNLPPTNQTAASPKYNLQQPKITATNFSPETASKTTAKMPREVADIKKFIEICRRKDASSARIKKNKKSNQVKFKVRCQTHLYTLILKDAEKAEKLKQSLPPNLTVIEVSKKEKKAKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.41
3 0.44
4 0.42
5 0.44
6 0.42
7 0.47
8 0.49
9 0.43
10 0.4
11 0.36
12 0.38
13 0.33
14 0.31
15 0.25
16 0.21
17 0.26
18 0.25
19 0.27
20 0.21
21 0.21
22 0.27
23 0.31
24 0.32
25 0.3
26 0.31
27 0.29
28 0.33
29 0.34
30 0.33
31 0.33
32 0.33
33 0.3
34 0.31
35 0.29
36 0.26
37 0.33
38 0.33
39 0.32
40 0.39
41 0.4
42 0.37
43 0.42
44 0.45
45 0.43
46 0.48
47 0.51
48 0.51
49 0.58
50 0.61
51 0.63
52 0.7
53 0.7
54 0.7
55 0.73
56 0.74
57 0.77
58 0.83
59 0.86
60 0.81
61 0.82
62 0.81
63 0.71
64 0.66
65 0.62
66 0.57
67 0.52
68 0.52
69 0.45
70 0.38
71 0.37
72 0.35
73 0.29
74 0.24
75 0.21
76 0.18
77 0.19
78 0.17
79 0.19
80 0.22
81 0.27
82 0.29
83 0.32
84 0.36
85 0.42
86 0.48
87 0.48
88 0.47
89 0.43
90 0.42
91 0.38
92 0.31
93 0.27
94 0.26
95 0.26
96 0.29
97 0.35
98 0.41
99 0.49