Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZAK2

Protein Details
Accession A0A2C5ZAK2    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
296-326IGGPKKCKTAETQRRKYRTKVDQRKKLLLSTHydrophilic
NLS Segment(s)
PositionSequence
6-22KKSPGKALGRARKEPAR
Subcellular Location(s) mito 12.5, cyto_mito 10, nucl 8, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MTASPKKSPGKALGRARKEPARQLAKFSNKLAVAMDVKGLKTASLPKLRSWAAKDTETGAITREVIGLLRRLVAVKEYVGEGKTDGLEVKGEVDEQRMSFDAVSVDRMSGETDYFEASSSLNREYAEDEMSVDGDSVRDSIAESMDEKKPMPIMSPGLFRQRVNGPDRFATLYRRAVTKQWCLYCVRYALRSYSERKTEVLRVECSPPTGGRIRCPTCCERNIVCNWIPAMMTGDRDDLMRILELMRLICSFAVVKAQRQRLALPLETRKTLASLAWDLTSDFVVAVNTHVKEQGIGGPKKCKTAETQRRKYRTKVDQRKKLLLSTFPVPKTRRGMEEDMLWKWEAQTSPRMTADEKAYPDWRQALHDSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.79
4 0.77
5 0.74
6 0.74
7 0.73
8 0.73
9 0.66
10 0.68
11 0.7
12 0.71
13 0.7
14 0.63
15 0.59
16 0.49
17 0.49
18 0.42
19 0.36
20 0.29
21 0.24
22 0.26
23 0.21
24 0.2
25 0.21
26 0.2
27 0.15
28 0.16
29 0.23
30 0.28
31 0.34
32 0.36
33 0.37
34 0.44
35 0.46
36 0.49
37 0.46
38 0.46
39 0.43
40 0.43
41 0.42
42 0.39
43 0.39
44 0.34
45 0.3
46 0.23
47 0.19
48 0.17
49 0.16
50 0.13
51 0.1
52 0.1
53 0.11
54 0.12
55 0.11
56 0.11
57 0.12
58 0.12
59 0.12
60 0.13
61 0.13
62 0.11
63 0.11
64 0.12
65 0.14
66 0.13
67 0.13
68 0.12
69 0.11
70 0.11
71 0.11
72 0.1
73 0.08
74 0.08
75 0.08
76 0.09
77 0.08
78 0.09
79 0.09
80 0.11
81 0.12
82 0.11
83 0.13
84 0.12
85 0.12
86 0.11
87 0.11
88 0.11
89 0.1
90 0.12
91 0.11
92 0.1
93 0.09
94 0.1
95 0.1
96 0.09
97 0.09
98 0.07
99 0.07
100 0.08
101 0.08
102 0.08
103 0.07
104 0.07
105 0.09
106 0.1
107 0.11
108 0.11
109 0.11
110 0.11
111 0.12
112 0.13
113 0.13
114 0.11
115 0.1
116 0.09
117 0.1
118 0.09
119 0.07
120 0.06
121 0.05
122 0.05
123 0.04
124 0.04
125 0.04
126 0.04
127 0.05
128 0.05
129 0.06
130 0.07
131 0.1
132 0.12
133 0.13
134 0.13
135 0.13
136 0.15
137 0.14
138 0.15
139 0.13
140 0.15
141 0.16
142 0.19
143 0.21
144 0.26
145 0.27
146 0.26
147 0.27
148 0.27
149 0.31
150 0.33
151 0.34
152 0.29
153 0.28
154 0.3
155 0.29
156 0.26
157 0.24
158 0.24
159 0.25
160 0.24
161 0.25
162 0.24
163 0.27
164 0.31
165 0.33
166 0.35
167 0.32
168 0.33
169 0.33
170 0.34
171 0.31
172 0.3
173 0.24
174 0.21
175 0.21
176 0.2
177 0.22
178 0.24
179 0.27
180 0.28
181 0.3
182 0.28
183 0.29
184 0.3
185 0.31
186 0.32
187 0.31
188 0.28
189 0.27
190 0.29
191 0.29
192 0.27
193 0.23
194 0.17
195 0.18
196 0.21
197 0.2
198 0.22
199 0.3
200 0.32
201 0.33
202 0.38
203 0.41
204 0.41
205 0.42
206 0.43
207 0.37
208 0.4
209 0.4
210 0.41
211 0.36
212 0.32
213 0.3
214 0.24
215 0.22
216 0.16
217 0.17
218 0.12
219 0.12
220 0.11
221 0.11
222 0.11
223 0.11
224 0.11
225 0.08
226 0.08
227 0.07
228 0.06
229 0.06
230 0.07
231 0.07
232 0.07
233 0.08
234 0.07
235 0.08
236 0.07
237 0.07
238 0.07
239 0.06
240 0.13
241 0.13
242 0.19
243 0.26
244 0.31
245 0.34
246 0.35
247 0.36
248 0.34
249 0.37
250 0.35
251 0.35
252 0.37
253 0.37
254 0.37
255 0.37
256 0.31
257 0.28
258 0.25
259 0.19
260 0.16
261 0.15
262 0.15
263 0.15
264 0.14
265 0.13
266 0.13
267 0.13
268 0.09
269 0.07
270 0.06
271 0.06
272 0.06
273 0.08
274 0.11
275 0.12
276 0.12
277 0.13
278 0.13
279 0.13
280 0.14
281 0.18
282 0.23
283 0.27
284 0.3
285 0.38
286 0.39
287 0.45
288 0.45
289 0.41
290 0.4
291 0.47
292 0.55
293 0.58
294 0.67
295 0.71
296 0.8
297 0.83
298 0.83
299 0.82
300 0.82
301 0.82
302 0.82
303 0.83
304 0.84
305 0.87
306 0.89
307 0.82
308 0.77
309 0.7
310 0.64
311 0.58
312 0.55
313 0.55
314 0.49
315 0.54
316 0.5
317 0.52
318 0.54
319 0.53
320 0.51
321 0.5
322 0.53
323 0.48
324 0.54
325 0.52
326 0.47
327 0.45
328 0.4
329 0.33
330 0.28
331 0.29
332 0.23
333 0.22
334 0.29
335 0.3
336 0.35
337 0.37
338 0.38
339 0.35
340 0.38
341 0.41
342 0.39
343 0.38
344 0.38
345 0.4
346 0.4
347 0.42
348 0.42
349 0.37
350 0.36