Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5ZDA3

Protein Details
Accession A0A2C5ZDA3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
83-105KTQERDKDNRTGKRERKKEAHHGBasic
NLS Segment(s)
PositionSequence
92-103RTGKRERKKEAH
Subcellular Location(s) nucl 12.5, cyto_nucl 12, cyto 8.5, mito 3
Family & Domain DBs
Amino Acid Sequences MNDSIGCEQEQRRTAEPGVLMTRALTKATRLDRRWITAADEVNEQGNSFSSADGPEKSTSEEGASLKQQQRNRAVPSPTDQAKTQERDKDNRTGKRERKKEAHHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.34
4 0.31
5 0.28
6 0.24
7 0.21
8 0.18
9 0.2
10 0.17
11 0.17
12 0.13
13 0.12
14 0.19
15 0.27
16 0.35
17 0.34
18 0.42
19 0.44
20 0.48
21 0.48
22 0.43
23 0.38
24 0.34
25 0.33
26 0.27
27 0.24
28 0.2
29 0.19
30 0.18
31 0.14
32 0.1
33 0.08
34 0.08
35 0.07
36 0.07
37 0.06
38 0.07
39 0.08
40 0.09
41 0.1
42 0.1
43 0.1
44 0.11
45 0.11
46 0.11
47 0.1
48 0.12
49 0.1
50 0.12
51 0.13
52 0.18
53 0.23
54 0.28
55 0.3
56 0.36
57 0.43
58 0.47
59 0.51
60 0.51
61 0.49
62 0.47
63 0.49
64 0.49
65 0.45
66 0.41
67 0.37
68 0.36
69 0.4
70 0.43
71 0.44
72 0.46
73 0.48
74 0.53
75 0.56
76 0.61
77 0.63
78 0.67
79 0.68
80 0.7
81 0.74
82 0.78
83 0.82
84 0.82
85 0.83