Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5ZG44

Protein Details
Accession A0A2C5ZG44    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
46-69WDSGRRSCGCRGRRRWDSRRRRCYBasic
NLS Segment(s)
Subcellular Location(s) extr 14, nucl 7, mito 3, plas 2
Family & Domain DBs
Amino Acid Sequences MHFTQFFVTALFAMGSVNAIANPEPEPEQAAAQYGNRCGNDRWSYWDSGRRSCGCRGRRRWDSRRRRCY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.04
6 0.05
7 0.05
8 0.06
9 0.07
10 0.08
11 0.09
12 0.09
13 0.11
14 0.11
15 0.11
16 0.1
17 0.1
18 0.09
19 0.1
20 0.11
21 0.11
22 0.13
23 0.13
24 0.15
25 0.15
26 0.21
27 0.22
28 0.22
29 0.28
30 0.28
31 0.31
32 0.32
33 0.39
34 0.35
35 0.37
36 0.43
37 0.39
38 0.4
39 0.45
40 0.51
41 0.53
42 0.61
43 0.66
44 0.7
45 0.77
46 0.84
47 0.86
48 0.89
49 0.91