Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YS41

Protein Details
Accession A0A2C5YS41   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
71-95HERAWKFSARRPPRRPLNHNPNLSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007306  Rit1  
IPR033421  Rit1_DUSP-like  
IPR033449  Rit1_N  
Gene Ontology GO:0043399  F:tRNA A64-2'-O-ribosylphosphate transferase activity  
GO:0019988  P:charged-tRNA amino acid modification  
Pfam View protein in Pfam  
PF04179  Init_tRNA_PT  
PF17184  Rit1_C  
Amino Acid Sequences MTPLSSPLTPLHASSLTPHNRLASIASDAAFIRSAALSIQRPLVANERCGAWYVGDGAQASSAYFKSTDGHERAWKFSARRPPRRPLNHNPNLSLLPIFVSDLAALCLDLGEYKLSKPLRPLWIGPDSPLPGPGPIFEDYTPVICCSASRVEAEGERTAGYVQGAADDAENWALGLTPSIFWRNVDALLAASDAHLPSLIATLITESRTTTSKASKQPRQLTPSLSVTALPLPPPTPETCQIALTATPTPPQTWIQSRNRMDVGLGRHKKASRNLRLALPDVCGFVARFVAAGGGRVMVGCESGRDVCVGAALALLCRVVDEGGCLRVMDEGRPLTKAVVKARLAAIMAAFPEANPSRQTLQSVNSFLLDWRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.32
3 0.33
4 0.34
5 0.36
6 0.33
7 0.32
8 0.33
9 0.31
10 0.23
11 0.21
12 0.21
13 0.19
14 0.18
15 0.18
16 0.19
17 0.17
18 0.14
19 0.11
20 0.09
21 0.09
22 0.09
23 0.14
24 0.15
25 0.16
26 0.18
27 0.19
28 0.2
29 0.22
30 0.3
31 0.27
32 0.27
33 0.27
34 0.26
35 0.25
36 0.27
37 0.25
38 0.16
39 0.14
40 0.15
41 0.15
42 0.15
43 0.14
44 0.12
45 0.12
46 0.12
47 0.11
48 0.1
49 0.09
50 0.09
51 0.09
52 0.09
53 0.1
54 0.14
55 0.22
56 0.24
57 0.28
58 0.34
59 0.36
60 0.39
61 0.42
62 0.43
63 0.38
64 0.41
65 0.48
66 0.52
67 0.6
68 0.64
69 0.71
70 0.76
71 0.84
72 0.86
73 0.86
74 0.87
75 0.85
76 0.82
77 0.74
78 0.67
79 0.57
80 0.49
81 0.38
82 0.27
83 0.18
84 0.14
85 0.12
86 0.08
87 0.07
88 0.06
89 0.06
90 0.07
91 0.06
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.05
99 0.06
100 0.06
101 0.12
102 0.14
103 0.15
104 0.19
105 0.25
106 0.31
107 0.33
108 0.34
109 0.34
110 0.39
111 0.38
112 0.36
113 0.33
114 0.28
115 0.25
116 0.25
117 0.2
118 0.14
119 0.14
120 0.13
121 0.12
122 0.12
123 0.13
124 0.12
125 0.13
126 0.13
127 0.14
128 0.14
129 0.11
130 0.1
131 0.08
132 0.08
133 0.09
134 0.11
135 0.11
136 0.11
137 0.12
138 0.12
139 0.14
140 0.16
141 0.14
142 0.13
143 0.11
144 0.11
145 0.1
146 0.09
147 0.08
148 0.06
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.04
157 0.04
158 0.04
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.04
165 0.05
166 0.07
167 0.07
168 0.07
169 0.09
170 0.09
171 0.09
172 0.09
173 0.08
174 0.06
175 0.07
176 0.07
177 0.05
178 0.04
179 0.05
180 0.04
181 0.04
182 0.04
183 0.03
184 0.03
185 0.04
186 0.04
187 0.03
188 0.03
189 0.04
190 0.05
191 0.06
192 0.06
193 0.06
194 0.07
195 0.08
196 0.1
197 0.12
198 0.16
199 0.23
200 0.31
201 0.4
202 0.46
203 0.54
204 0.61
205 0.65
206 0.66
207 0.62
208 0.57
209 0.52
210 0.48
211 0.4
212 0.32
213 0.25
214 0.2
215 0.2
216 0.16
217 0.12
218 0.1
219 0.09
220 0.1
221 0.12
222 0.13
223 0.15
224 0.17
225 0.22
226 0.22
227 0.22
228 0.22
229 0.2
230 0.18
231 0.16
232 0.16
233 0.11
234 0.12
235 0.12
236 0.13
237 0.14
238 0.16
239 0.19
240 0.23
241 0.32
242 0.38
243 0.48
244 0.5
245 0.51
246 0.5
247 0.46
248 0.4
249 0.35
250 0.34
251 0.35
252 0.37
253 0.34
254 0.38
255 0.41
256 0.46
257 0.51
258 0.55
259 0.54
260 0.58
261 0.59
262 0.6
263 0.6
264 0.57
265 0.49
266 0.41
267 0.32
268 0.24
269 0.21
270 0.17
271 0.14
272 0.11
273 0.1
274 0.07
275 0.06
276 0.06
277 0.07
278 0.06
279 0.07
280 0.07
281 0.07
282 0.07
283 0.07
284 0.07
285 0.05
286 0.06
287 0.05
288 0.06
289 0.08
290 0.08
291 0.09
292 0.09
293 0.09
294 0.08
295 0.09
296 0.09
297 0.06
298 0.07
299 0.06
300 0.06
301 0.06
302 0.06
303 0.05
304 0.05
305 0.06
306 0.05
307 0.05
308 0.07
309 0.09
310 0.1
311 0.11
312 0.11
313 0.1
314 0.14
315 0.15
316 0.13
317 0.17
318 0.19
319 0.2
320 0.22
321 0.22
322 0.21
323 0.25
324 0.29
325 0.3
326 0.35
327 0.35
328 0.37
329 0.38
330 0.38
331 0.34
332 0.29
333 0.23
334 0.16
335 0.15
336 0.13
337 0.11
338 0.09
339 0.16
340 0.17
341 0.19
342 0.18
343 0.22
344 0.25
345 0.27
346 0.31
347 0.27
348 0.31
349 0.36
350 0.37
351 0.35
352 0.31
353 0.3