Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5XNM3

Protein Details
Accession A0A2C5XNM3    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
31-52PDGPWRRKVTKIKKDLIHKAKVBasic
NLS Segment(s)
PositionSequence
5-62RKRDASEPGPVPEKPRRGFRVGPDNLPDGPWRRKVTKIKKDLIHKAKVKKAYAKIKAR
141-188TRRAEAEERAAERQRRLDERDRRLAERERFRKAMAKTRDSSGRKKLGR
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MTLKRKRDASEPGPVPEKPRRGFRVGPDNLPDGPWRRKVTKIKKDLIHKAKVKKAYAKIKARELADKPTPADEKPADQAPQVTDDDDDEVQPSLHPTRELMLKDEDKAQAGSGGDTTTADGQRRRNRRPGYYDKQLQKAATRRAEAEERAAERQRRLDERDRRLAERERFRKAMAKTRDSSGRKKLGRESTLLLEKVKRLVADDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.52
4 0.55
5 0.49
6 0.55
7 0.56
8 0.58
9 0.62
10 0.64
11 0.66
12 0.62
13 0.62
14 0.56
15 0.53
16 0.47
17 0.43
18 0.39
19 0.34
20 0.36
21 0.39
22 0.4
23 0.4
24 0.49
25 0.59
26 0.66
27 0.7
28 0.73
29 0.74
30 0.75
31 0.82
32 0.83
33 0.81
34 0.79
35 0.76
36 0.75
37 0.73
38 0.74
39 0.69
40 0.67
41 0.67
42 0.68
43 0.7
44 0.72
45 0.69
46 0.7
47 0.69
48 0.63
49 0.61
50 0.53
51 0.51
52 0.46
53 0.43
54 0.36
55 0.36
56 0.36
57 0.28
58 0.31
59 0.25
60 0.22
61 0.23
62 0.25
63 0.21
64 0.2
65 0.21
66 0.16
67 0.19
68 0.17
69 0.14
70 0.11
71 0.11
72 0.13
73 0.11
74 0.1
75 0.08
76 0.08
77 0.07
78 0.07
79 0.08
80 0.08
81 0.08
82 0.08
83 0.08
84 0.09
85 0.13
86 0.14
87 0.15
88 0.18
89 0.18
90 0.19
91 0.21
92 0.2
93 0.16
94 0.16
95 0.13
96 0.11
97 0.1
98 0.09
99 0.07
100 0.07
101 0.06
102 0.06
103 0.06
104 0.07
105 0.08
106 0.1
107 0.13
108 0.21
109 0.29
110 0.37
111 0.43
112 0.5
113 0.55
114 0.6
115 0.66
116 0.69
117 0.69
118 0.7
119 0.73
120 0.69
121 0.69
122 0.64
123 0.56
124 0.53
125 0.52
126 0.51
127 0.47
128 0.43
129 0.39
130 0.4
131 0.43
132 0.37
133 0.34
134 0.31
135 0.28
136 0.31
137 0.36
138 0.35
139 0.33
140 0.38
141 0.39
142 0.4
143 0.45
144 0.5
145 0.55
146 0.6
147 0.68
148 0.66
149 0.63
150 0.65
151 0.67
152 0.66
153 0.67
154 0.65
155 0.63
156 0.6
157 0.6
158 0.61
159 0.57
160 0.58
161 0.56
162 0.57
163 0.52
164 0.56
165 0.64
166 0.62
167 0.65
168 0.64
169 0.65
170 0.61
171 0.64
172 0.67
173 0.67
174 0.65
175 0.61
176 0.56
177 0.54
178 0.57
179 0.53
180 0.47
181 0.4
182 0.39
183 0.38
184 0.36
185 0.28