Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PKX7

Protein Details
Accession J3PKX7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
68-88CTNKKEVKKGLPSRRRRVSRSBasic
NLS Segment(s)
PositionSequence
72-84KEVKKGLPSRRRR
Subcellular Location(s) cyto 12, extr 6, mito 4, pero 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPDVPGLPLGGLAGGGAVLAAPAAGLAARRRAEGTKGYGYAGHLGVFGCWAAWAAERTGVVICDVCCCTNKKEVKKGLPSRRRRVSRSLPEAQIRFEDGSGRNSQALQPSTDNCLSACNPTECRVRAAGDEAAAAAAAGELLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.02
4 0.02
5 0.02
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.04
13 0.06
14 0.12
15 0.13
16 0.14
17 0.16
18 0.18
19 0.21
20 0.24
21 0.28
22 0.27
23 0.27
24 0.27
25 0.26
26 0.25
27 0.24
28 0.2
29 0.14
30 0.1
31 0.1
32 0.09
33 0.08
34 0.07
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.06
41 0.06
42 0.07
43 0.07
44 0.08
45 0.08
46 0.08
47 0.07
48 0.07
49 0.07
50 0.07
51 0.08
52 0.08
53 0.1
54 0.12
55 0.13
56 0.21
57 0.27
58 0.31
59 0.39
60 0.45
61 0.51
62 0.59
63 0.67
64 0.7
65 0.73
66 0.77
67 0.78
68 0.81
69 0.8
70 0.75
71 0.74
72 0.74
73 0.74
74 0.72
75 0.69
76 0.64
77 0.63
78 0.6
79 0.52
80 0.43
81 0.35
82 0.27
83 0.21
84 0.2
85 0.16
86 0.19
87 0.19
88 0.2
89 0.18
90 0.18
91 0.2
92 0.22
93 0.22
94 0.2
95 0.21
96 0.21
97 0.26
98 0.26
99 0.25
100 0.19
101 0.21
102 0.19
103 0.21
104 0.23
105 0.21
106 0.23
107 0.27
108 0.34
109 0.32
110 0.34
111 0.33
112 0.3
113 0.28
114 0.31
115 0.28
116 0.22
117 0.2
118 0.17
119 0.15
120 0.13
121 0.1
122 0.06
123 0.04