Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5ZJS5

Protein Details
Accession A0A2C5ZJS5    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
69-94HFRFGGQKRRCMRRRNYEFKKVNAGNHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, pero 5, nucl 4, mito 4, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MTYLALLAATCAADTLHTSHHVHSGRHVHGDWRTNNGAVHSINADDGCRTPNVPGMVDFCIDYRRQRLHFRFGGQKRRCMRRRNYEFKKVNAGNYEFTEWNEAPCDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.08
3 0.1
4 0.14
5 0.15
6 0.16
7 0.24
8 0.27
9 0.26
10 0.31
11 0.36
12 0.34
13 0.36
14 0.36
15 0.33
16 0.35
17 0.42
18 0.36
19 0.35
20 0.34
21 0.31
22 0.31
23 0.28
24 0.26
25 0.18
26 0.18
27 0.12
28 0.11
29 0.1
30 0.1
31 0.09
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.1
39 0.11
40 0.11
41 0.11
42 0.12
43 0.12
44 0.12
45 0.12
46 0.09
47 0.1
48 0.11
49 0.12
50 0.15
51 0.18
52 0.22
53 0.32
54 0.36
55 0.42
56 0.45
57 0.48
58 0.54
59 0.57
60 0.64
61 0.59
62 0.63
63 0.63
64 0.7
65 0.73
66 0.73
67 0.75
68 0.75
69 0.82
70 0.85
71 0.86
72 0.86
73 0.85
74 0.8
75 0.8
76 0.72
77 0.66
78 0.62
79 0.56
80 0.48
81 0.45
82 0.45
83 0.35
84 0.34
85 0.35
86 0.28
87 0.27