Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YCP4

Protein Details
Accession A0A2C5YCP4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MRMMKKREEREKKKKKKPKGGAQSEFWAKBasic
NLS Segment(s)
PositionSequence
5-21KKREEREKKKKKKPKGG
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR042831  YmL28  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MRMMKKREEREKKKKKKPKGGAQSEFWAKVRVLRQDMFINPPPALRMGRLRHLRHWTIHRAWQLYRRHVKEAFVTERQRIYAGMYWACEELRRTQWPANRSEGYLYRTSQEKKGLWKTPSVVPIEYTRYQTETPPLVPWNHDWKRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.95
3 0.95
4 0.95
5 0.95
6 0.95
7 0.94
8 0.9
9 0.84
10 0.81
11 0.75
12 0.66
13 0.56
14 0.47
15 0.36
16 0.35
17 0.35
18 0.34
19 0.33
20 0.31
21 0.34
22 0.36
23 0.38
24 0.38
25 0.38
26 0.34
27 0.29
28 0.28
29 0.25
30 0.23
31 0.22
32 0.18
33 0.21
34 0.22
35 0.31
36 0.39
37 0.41
38 0.46
39 0.52
40 0.53
41 0.51
42 0.54
43 0.53
44 0.47
45 0.51
46 0.48
47 0.43
48 0.42
49 0.44
50 0.44
51 0.45
52 0.5
53 0.47
54 0.47
55 0.46
56 0.45
57 0.41
58 0.42
59 0.38
60 0.35
61 0.34
62 0.32
63 0.31
64 0.3
65 0.26
66 0.2
67 0.18
68 0.14
69 0.15
70 0.13
71 0.13
72 0.14
73 0.14
74 0.13
75 0.12
76 0.1
77 0.12
78 0.17
79 0.19
80 0.22
81 0.26
82 0.31
83 0.34
84 0.36
85 0.39
86 0.35
87 0.33
88 0.34
89 0.33
90 0.33
91 0.32
92 0.29
93 0.24
94 0.29
95 0.31
96 0.31
97 0.34
98 0.33
99 0.39
100 0.47
101 0.53
102 0.49
103 0.51
104 0.5
105 0.49
106 0.52
107 0.46
108 0.38
109 0.33
110 0.35
111 0.37
112 0.36
113 0.33
114 0.3
115 0.3
116 0.3
117 0.3
118 0.33
119 0.3
120 0.29
121 0.3
122 0.31
123 0.3
124 0.32
125 0.35
126 0.4