Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5XX20

Protein Details
Accession A0A2C5XX20    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
78-104FLARKRSKTGQNILKRRLKKGRKTLAWHydrophilic
NLS Segment(s)
PositionSequence
73-101KRRSGFLARKRSKTGQNILKRRLKKGRKT
Subcellular Location(s) mito 22, nucl 2, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MAFRFLSRTFGCLSVLPPLRPSITPSVRQLPFRALEADLVSHGALTTHPALASMQLRFSRRNTMNGATRLLQKRRSGFLARKRSKTGQNILKRRLKKGRKTLAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.25
4 0.24
5 0.25
6 0.26
7 0.25
8 0.28
9 0.29
10 0.3
11 0.34
12 0.37
13 0.44
14 0.44
15 0.46
16 0.43
17 0.38
18 0.34
19 0.32
20 0.29
21 0.2
22 0.19
23 0.17
24 0.16
25 0.11
26 0.1
27 0.09
28 0.07
29 0.06
30 0.05
31 0.04
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.07
38 0.08
39 0.1
40 0.08
41 0.1
42 0.13
43 0.15
44 0.17
45 0.18
46 0.26
47 0.26
48 0.3
49 0.31
50 0.34
51 0.39
52 0.39
53 0.4
54 0.32
55 0.38
56 0.41
57 0.42
58 0.42
59 0.41
60 0.43
61 0.44
62 0.47
63 0.47
64 0.49
65 0.55
66 0.61
67 0.63
68 0.65
69 0.68
70 0.69
71 0.71
72 0.71
73 0.71
74 0.7
75 0.73
76 0.77
77 0.79
78 0.82
79 0.79
80 0.79
81 0.8
82 0.81
83 0.81
84 0.82