Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PCW3

Protein Details
Accession J3PCW3    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
25-44TANIKIKRPSKKLSNKWLGPHydrophilic
74-107TNLLRAFKKKPGEKPKNKKPKIEKKEKDCFKVKABasic
NLS Segment(s)
PositionSequence
80-123FKKKPGEKPKNKKPKIEKKEKDCFKVKALLKYKGLLRKRKYLIK
Subcellular Location(s) mito 21.5, mito_nucl 13.5, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MYKKYYNKSRTPVPFGVSNWVLLNTANIKIKRPSKKLSNKWLGPFQVLKMVGLAGLAFRLKLSVSYQIHNVFLTNLLRAFKKKPGEKPKNKKPKIEKKEKDCFKVKALLKYKGLLRKRKYLIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.53
3 0.54
4 0.44
5 0.37
6 0.29
7 0.26
8 0.23
9 0.17
10 0.18
11 0.13
12 0.16
13 0.21
14 0.21
15 0.23
16 0.3
17 0.39
18 0.46
19 0.5
20 0.54
21 0.58
22 0.69
23 0.75
24 0.79
25 0.8
26 0.76
27 0.75
28 0.73
29 0.64
30 0.56
31 0.48
32 0.38
33 0.33
34 0.28
35 0.23
36 0.17
37 0.15
38 0.11
39 0.1
40 0.09
41 0.03
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.04
49 0.06
50 0.13
51 0.15
52 0.16
53 0.19
54 0.2
55 0.2
56 0.2
57 0.18
58 0.11
59 0.12
60 0.11
61 0.09
62 0.09
63 0.1
64 0.12
65 0.14
66 0.17
67 0.21
68 0.29
69 0.35
70 0.44
71 0.54
72 0.65
73 0.74
74 0.82
75 0.86
76 0.89
77 0.89
78 0.88
79 0.88
80 0.88
81 0.88
82 0.88
83 0.87
84 0.85
85 0.91
86 0.89
87 0.86
88 0.82
89 0.75
90 0.69
91 0.68
92 0.64
93 0.63
94 0.63
95 0.62
96 0.57
97 0.58
98 0.6
99 0.6
100 0.64
101 0.64
102 0.62
103 0.65