Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5Y577

Protein Details
Accession A0A2C5Y577   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-34IRMEQGPRANSKRRKHTKKYAQELLSTHydrophilic
NLS Segment(s)
PositionSequence
18-24SKRRKHT
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011893  Selenoprotein_Rdx-typ  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF10262  Rdx  
Amino Acid Sequences MNISATSIRMEQGPRANSKRRKHTKKYAQELLSTFPTLGEVALQPGGSGTFTMTLTTSHDAPGPSPDSCESSAAADVEPLACAATPQTRTTVLWDRRRDSGFPETKTLKRLVRDVIEPSRTLGHIDGLPSAPPPECLDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.43
3 0.53
4 0.59
5 0.67
6 0.73
7 0.77
8 0.83
9 0.84
10 0.89
11 0.9
12 0.91
13 0.92
14 0.9
15 0.82
16 0.76
17 0.68
18 0.61
19 0.52
20 0.42
21 0.32
22 0.22
23 0.19
24 0.14
25 0.12
26 0.09
27 0.06
28 0.07
29 0.07
30 0.07
31 0.06
32 0.06
33 0.06
34 0.05
35 0.05
36 0.04
37 0.05
38 0.05
39 0.06
40 0.06
41 0.06
42 0.09
43 0.1
44 0.1
45 0.09
46 0.11
47 0.11
48 0.11
49 0.13
50 0.13
51 0.12
52 0.13
53 0.13
54 0.14
55 0.14
56 0.15
57 0.12
58 0.1
59 0.11
60 0.1
61 0.09
62 0.07
63 0.06
64 0.05
65 0.05
66 0.04
67 0.03
68 0.03
69 0.03
70 0.04
71 0.07
72 0.09
73 0.1
74 0.12
75 0.13
76 0.13
77 0.19
78 0.28
79 0.33
80 0.41
81 0.46
82 0.47
83 0.51
84 0.53
85 0.49
86 0.44
87 0.46
88 0.44
89 0.41
90 0.45
91 0.45
92 0.45
93 0.47
94 0.47
95 0.41
96 0.38
97 0.39
98 0.39
99 0.38
100 0.39
101 0.42
102 0.44
103 0.43
104 0.4
105 0.38
106 0.34
107 0.31
108 0.29
109 0.23
110 0.18
111 0.16
112 0.17
113 0.17
114 0.16
115 0.16
116 0.15
117 0.16
118 0.14
119 0.14