Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5Y4X7

Protein Details
Accession A0A2C5Y4X7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
244-278LAVKFKSPRRAQVKAKKGKKGKKSKKELAAAAKKIHydrophilic
NLS Segment(s)
PositionSequence
227-281RKRAESESKKPLKVKGLLAVKFKSPRRAQVKAKKGKKGKKSKKELAAAAKKIPKK
Subcellular Location(s) mito 15.5, mito_nucl 12.666, nucl 8.5, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR034704  L28p-like  
IPR026569  Ribo_L28/L24  
IPR037147  Ribo_L28/L24_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF00830  Ribosomal_L28  
Amino Acid Sequences MPSSVWASLARRHAAPGTRSFSTTPPRLRKTFVAHQIPSRIVPPYPYGYRQVYKQSNKGLYGSSRIRFGNTVSEKWNRKSRRSWSPNVLVKIFKSPSLKARFRARLTISTLKTIAHEGGIENYLLKSKAARIKDLGPTGWRLRWLLMQTRAVQRRFNEERKAMGLEEKPIVDNDHVINYALDCACQGRLNLRNRALHAKRPNMDTIFLGGDEPPPNANDFDKIENLRKRAESESKKPLKVKGLLAVKFKSPRRAQVKAKKGKKGKKSKKELAAAAKKIPKKVATPWNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.43
4 0.43
5 0.42
6 0.43
7 0.43
8 0.43
9 0.45
10 0.48
11 0.5
12 0.53
13 0.59
14 0.6
15 0.63
16 0.64
17 0.64
18 0.65
19 0.66
20 0.65
21 0.61
22 0.63
23 0.63
24 0.58
25 0.51
26 0.43
27 0.35
28 0.27
29 0.26
30 0.25
31 0.26
32 0.28
33 0.3
34 0.34
35 0.37
36 0.39
37 0.41
38 0.46
39 0.49
40 0.52
41 0.56
42 0.59
43 0.58
44 0.57
45 0.54
46 0.48
47 0.4
48 0.41
49 0.41
50 0.34
51 0.33
52 0.32
53 0.32
54 0.29
55 0.28
56 0.31
57 0.29
58 0.3
59 0.31
60 0.39
61 0.42
62 0.47
63 0.55
64 0.51
65 0.54
66 0.6
67 0.64
68 0.67
69 0.7
70 0.72
71 0.72
72 0.76
73 0.76
74 0.71
75 0.64
76 0.54
77 0.47
78 0.46
79 0.38
80 0.32
81 0.29
82 0.27
83 0.33
84 0.41
85 0.43
86 0.42
87 0.51
88 0.55
89 0.54
90 0.59
91 0.53
92 0.49
93 0.53
94 0.55
95 0.46
96 0.41
97 0.39
98 0.32
99 0.29
100 0.26
101 0.19
102 0.11
103 0.1
104 0.07
105 0.08
106 0.09
107 0.08
108 0.07
109 0.07
110 0.07
111 0.07
112 0.07
113 0.06
114 0.11
115 0.16
116 0.18
117 0.19
118 0.2
119 0.24
120 0.29
121 0.3
122 0.26
123 0.21
124 0.24
125 0.24
126 0.23
127 0.2
128 0.16
129 0.15
130 0.17
131 0.18
132 0.2
133 0.22
134 0.24
135 0.26
136 0.34
137 0.39
138 0.37
139 0.38
140 0.33
141 0.39
142 0.43
143 0.45
144 0.43
145 0.39
146 0.4
147 0.39
148 0.39
149 0.3
150 0.27
151 0.23
152 0.19
153 0.19
154 0.17
155 0.15
156 0.14
157 0.15
158 0.11
159 0.11
160 0.1
161 0.1
162 0.1
163 0.1
164 0.1
165 0.08
166 0.1
167 0.08
168 0.07
169 0.06
170 0.07
171 0.07
172 0.08
173 0.09
174 0.12
175 0.2
176 0.27
177 0.33
178 0.38
179 0.4
180 0.42
181 0.52
182 0.49
183 0.51
184 0.53
185 0.55
186 0.53
187 0.53
188 0.56
189 0.47
190 0.45
191 0.36
192 0.3
193 0.23
194 0.19
195 0.16
196 0.12
197 0.13
198 0.13
199 0.13
200 0.11
201 0.11
202 0.12
203 0.13
204 0.14
205 0.14
206 0.15
207 0.18
208 0.21
209 0.24
210 0.31
211 0.36
212 0.37
213 0.38
214 0.37
215 0.38
216 0.41
217 0.48
218 0.48
219 0.51
220 0.6
221 0.64
222 0.68
223 0.68
224 0.67
225 0.64
226 0.61
227 0.57
228 0.55
229 0.56
230 0.55
231 0.57
232 0.53
233 0.51
234 0.53
235 0.54
236 0.55
237 0.51
238 0.56
239 0.58
240 0.65
241 0.7
242 0.73
243 0.79
244 0.8
245 0.85
246 0.85
247 0.87
248 0.88
249 0.88
250 0.89
251 0.89
252 0.89
253 0.91
254 0.91
255 0.91
256 0.9
257 0.87
258 0.87
259 0.86
260 0.8
261 0.77
262 0.75
263 0.7
264 0.66
265 0.64
266 0.57
267 0.52
268 0.57