Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3PB00

Protein Details
Accession J3PB00    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
152-173LLRRRRGPVGRGRRHLPRRLRLBasic
NLS Segment(s)
PositionSequence
151-173PLLRRRRGPVGRGRRHLPRRLRL
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007828  Inositol_oxygenase  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0050113  F:inositol oxygenase activity  
GO:0005506  F:iron ion binding  
GO:0019310  P:inositol catabolic process  
Pfam View protein in Pfam  
PF05153  MIOX  
Amino Acid Sequences MAPSAIYEDSIVVDVKKSGQALEDMSDRIDAVNVLKSNKAPAPAPQAQQDEAFDSESRFDSAKDKGQFRQYEEACDRVKNFYREQHEKQTVAYNLKARAHFASASRKRMEMTVWEAMEKLNTLIDESDPDTSLSQIQHLLQSAEAIRRDAPLLRRRRGPVGRGRRHLPRRLRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.13
4 0.12
5 0.12
6 0.12
7 0.14
8 0.15
9 0.17
10 0.18
11 0.16
12 0.16
13 0.15
14 0.14
15 0.12
16 0.11
17 0.08
18 0.08
19 0.13
20 0.14
21 0.15
22 0.16
23 0.17
24 0.2
25 0.22
26 0.23
27 0.18
28 0.21
29 0.29
30 0.33
31 0.35
32 0.37
33 0.38
34 0.36
35 0.36
36 0.33
37 0.26
38 0.22
39 0.21
40 0.15
41 0.13
42 0.13
43 0.13
44 0.13
45 0.11
46 0.11
47 0.12
48 0.14
49 0.22
50 0.25
51 0.27
52 0.3
53 0.38
54 0.39
55 0.41
56 0.47
57 0.39
58 0.42
59 0.4
60 0.41
61 0.34
62 0.33
63 0.3
64 0.25
65 0.3
66 0.26
67 0.28
68 0.29
69 0.36
70 0.42
71 0.46
72 0.5
73 0.48
74 0.45
75 0.44
76 0.43
77 0.38
78 0.33
79 0.31
80 0.25
81 0.25
82 0.29
83 0.28
84 0.24
85 0.22
86 0.21
87 0.2
88 0.2
89 0.28
90 0.3
91 0.35
92 0.34
93 0.34
94 0.32
95 0.32
96 0.3
97 0.23
98 0.23
99 0.23
100 0.22
101 0.22
102 0.21
103 0.2
104 0.2
105 0.16
106 0.1
107 0.06
108 0.06
109 0.06
110 0.07
111 0.07
112 0.09
113 0.1
114 0.1
115 0.1
116 0.11
117 0.11
118 0.11
119 0.13
120 0.11
121 0.11
122 0.12
123 0.12
124 0.13
125 0.14
126 0.14
127 0.11
128 0.13
129 0.14
130 0.17
131 0.17
132 0.16
133 0.16
134 0.16
135 0.18
136 0.21
137 0.27
138 0.32
139 0.4
140 0.45
141 0.52
142 0.56
143 0.64
144 0.67
145 0.67
146 0.69
147 0.72
148 0.76
149 0.76
150 0.78
151 0.79
152 0.81
153 0.82