Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3PA85

Protein Details
Accession J3PA85    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
179-209ASLLQRLGGPRRKKGKKRKRGGVVSGRVTKSBasic
NLS Segment(s)
PositionSequence
186-200GGPRRKKGKKRKRGG
Subcellular Location(s) nucl 15.5, cyto_nucl 14.5, cyto 10.5
Family & Domain DBs
Amino Acid Sequences MVIVISDDEDGGPPPSQSHFAKFEDFKPDDAAPFDQEFSRLASSQEWVPGSQEYTRQRTIAMREELQLHYFSQPPPKLEVVDEEDEKAEPASAQEIALRGYQELCREVGLDEEAAGGNVDECKKALKSTLVNIVDLIDARRTHAKVEVWTDFEKFRAYTLQDGKRIDPKEARASPGYLASLLQRLGGPRRKKGKKRKRGGVVSGRVTKSEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.19
4 0.2
5 0.25
6 0.27
7 0.29
8 0.36
9 0.37
10 0.39
11 0.43
12 0.43
13 0.39
14 0.38
15 0.36
16 0.31
17 0.31
18 0.29
19 0.23
20 0.23
21 0.23
22 0.18
23 0.18
24 0.17
25 0.17
26 0.17
27 0.14
28 0.14
29 0.14
30 0.15
31 0.16
32 0.19
33 0.17
34 0.15
35 0.16
36 0.16
37 0.17
38 0.17
39 0.22
40 0.24
41 0.29
42 0.3
43 0.29
44 0.29
45 0.32
46 0.35
47 0.36
48 0.35
49 0.3
50 0.3
51 0.33
52 0.33
53 0.3
54 0.26
55 0.19
56 0.16
57 0.17
58 0.17
59 0.22
60 0.23
61 0.23
62 0.26
63 0.26
64 0.25
65 0.23
66 0.26
67 0.22
68 0.23
69 0.22
70 0.19
71 0.18
72 0.17
73 0.17
74 0.14
75 0.08
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.07
84 0.08
85 0.08
86 0.07
87 0.08
88 0.09
89 0.09
90 0.1
91 0.09
92 0.08
93 0.09
94 0.08
95 0.08
96 0.07
97 0.06
98 0.05
99 0.05
100 0.05
101 0.04
102 0.04
103 0.03
104 0.03
105 0.05
106 0.05
107 0.05
108 0.05
109 0.07
110 0.07
111 0.08
112 0.1
113 0.13
114 0.15
115 0.18
116 0.27
117 0.26
118 0.25
119 0.25
120 0.24
121 0.2
122 0.18
123 0.16
124 0.09
125 0.09
126 0.1
127 0.15
128 0.15
129 0.16
130 0.2
131 0.21
132 0.22
133 0.27
134 0.28
135 0.27
136 0.28
137 0.29
138 0.25
139 0.23
140 0.22
141 0.17
142 0.15
143 0.15
144 0.16
145 0.22
146 0.3
147 0.36
148 0.39
149 0.41
150 0.43
151 0.47
152 0.46
153 0.44
154 0.41
155 0.4
156 0.45
157 0.46
158 0.47
159 0.42
160 0.42
161 0.38
162 0.35
163 0.3
164 0.2
165 0.18
166 0.15
167 0.15
168 0.14
169 0.14
170 0.12
171 0.15
172 0.23
173 0.31
174 0.36
175 0.43
176 0.54
177 0.64
178 0.74
179 0.82
180 0.85
181 0.87
182 0.92
183 0.93
184 0.93
185 0.93
186 0.93
187 0.92
188 0.9
189 0.88
190 0.86
191 0.76