Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P538

Protein Details
Accession J3P538    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
76-117AKDARRHCPLRPGRRPVPHRARRRRRRRDCKARPARGCSALKBasic
NLS Segment(s)
PositionSequence
84-109PLRPGRRPVPHRARRRRRRRDCKARP
Subcellular Location(s) mito 11, cyto 8, nucl 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016166  FAD-bd_PCMH  
IPR036318  FAD-bd_PCMH-like_sf  
IPR016169  FAD-bd_PCMH_sub2  
IPR006094  Oxid_FAD_bind_N  
Gene Ontology GO:0071949  F:FAD binding  
Pfam View protein in Pfam  
PF01565  FAD_binding_4  
PROSITE View protein in PROSITE  
PS51387  FAD_PCMH  
Amino Acid Sequences MGAMTSTCLPETVGSQAAVGARALQAMDGMLYLPGELWVFHVVPQISSQCAQHAPAGRHRRPATGIVQVRQVADDAKDARRHCPLRPGRRPVPHRARRRRRRRDCKARPARGCSALKAALPDSVFFPRDAVYAAEAAAFWSNTQLMNPGCSVRGGGHMGIRGANNIDGGGMLIVMPGLATLELSPNGKRVDLGPALKWGAVYKYLAQHNLTAPGGRLSPVGVPGLLLGGGVSFIGNQVGWAADNVVEYEVVLASGDVVKVNKDASPDLFWALKGSSANFGIVTKFTVNTFPFTTVYAGTYTVSAAHGPAFLDAIANYTSGAIDPLSHMVPMAVPAAPGVTVYSAILFYDSPTESAPECFREFLALPAVSTTMGFKTVADFTVETGKLVVDKINDVFIAGTTVGHDYESQRRGIEITNRPIGAVWQEASERQNPAGFQDGYTGYGAANKQKLLDVSRKYDSERVFQKLWPGGFKIGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.16
4 0.16
5 0.16
6 0.14
7 0.12
8 0.09
9 0.1
10 0.1
11 0.08
12 0.07
13 0.07
14 0.07
15 0.05
16 0.06
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.06
23 0.05
24 0.07
25 0.1
26 0.1
27 0.12
28 0.17
29 0.17
30 0.17
31 0.2
32 0.2
33 0.2
34 0.21
35 0.2
36 0.18
37 0.2
38 0.21
39 0.22
40 0.28
41 0.3
42 0.38
43 0.49
44 0.49
45 0.57
46 0.58
47 0.57
48 0.54
49 0.55
50 0.5
51 0.5
52 0.52
53 0.44
54 0.48
55 0.45
56 0.42
57 0.36
58 0.32
59 0.23
60 0.18
61 0.21
62 0.2
63 0.23
64 0.29
65 0.3
66 0.34
67 0.41
68 0.43
69 0.41
70 0.48
71 0.53
72 0.59
73 0.68
74 0.73
75 0.73
76 0.8
77 0.83
78 0.84
79 0.85
80 0.83
81 0.84
82 0.86
83 0.88
84 0.89
85 0.94
86 0.95
87 0.95
88 0.97
89 0.97
90 0.97
91 0.97
92 0.97
93 0.97
94 0.96
95 0.93
96 0.89
97 0.84
98 0.82
99 0.73
100 0.64
101 0.58
102 0.5
103 0.42
104 0.36
105 0.3
106 0.24
107 0.22
108 0.2
109 0.17
110 0.18
111 0.18
112 0.16
113 0.16
114 0.13
115 0.13
116 0.14
117 0.12
118 0.09
119 0.09
120 0.09
121 0.08
122 0.07
123 0.08
124 0.08
125 0.07
126 0.05
127 0.06
128 0.07
129 0.07
130 0.07
131 0.1
132 0.09
133 0.11
134 0.12
135 0.12
136 0.11
137 0.11
138 0.12
139 0.09
140 0.12
141 0.12
142 0.12
143 0.13
144 0.13
145 0.14
146 0.15
147 0.14
148 0.12
149 0.11
150 0.1
151 0.09
152 0.07
153 0.07
154 0.05
155 0.05
156 0.04
157 0.03
158 0.03
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.04
169 0.05
170 0.06
171 0.07
172 0.1
173 0.11
174 0.11
175 0.11
176 0.11
177 0.16
178 0.19
179 0.2
180 0.18
181 0.2
182 0.21
183 0.2
184 0.19
185 0.14
186 0.11
187 0.11
188 0.11
189 0.1
190 0.15
191 0.17
192 0.19
193 0.19
194 0.2
195 0.19
196 0.21
197 0.19
198 0.14
199 0.13
200 0.12
201 0.11
202 0.1
203 0.09
204 0.07
205 0.07
206 0.08
207 0.08
208 0.06
209 0.06
210 0.05
211 0.05
212 0.04
213 0.04
214 0.02
215 0.02
216 0.02
217 0.02
218 0.02
219 0.02
220 0.02
221 0.02
222 0.02
223 0.02
224 0.03
225 0.03
226 0.03
227 0.03
228 0.03
229 0.04
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.03
237 0.03
238 0.03
239 0.02
240 0.03
241 0.03
242 0.03
243 0.04
244 0.04
245 0.04
246 0.05
247 0.06
248 0.07
249 0.08
250 0.09
251 0.1
252 0.12
253 0.12
254 0.13
255 0.13
256 0.12
257 0.12
258 0.11
259 0.11
260 0.09
261 0.09
262 0.1
263 0.1
264 0.1
265 0.09
266 0.09
267 0.08
268 0.08
269 0.09
270 0.08
271 0.08
272 0.08
273 0.12
274 0.12
275 0.14
276 0.15
277 0.16
278 0.16
279 0.16
280 0.17
281 0.13
282 0.13
283 0.11
284 0.11
285 0.09
286 0.09
287 0.08
288 0.07
289 0.07
290 0.06
291 0.06
292 0.06
293 0.06
294 0.06
295 0.06
296 0.06
297 0.05
298 0.05
299 0.05
300 0.06
301 0.06
302 0.06
303 0.06
304 0.06
305 0.06
306 0.06
307 0.06
308 0.04
309 0.04
310 0.05
311 0.07
312 0.07
313 0.07
314 0.07
315 0.06
316 0.06
317 0.07
318 0.07
319 0.06
320 0.05
321 0.05
322 0.06
323 0.05
324 0.05
325 0.05
326 0.04
327 0.04
328 0.04
329 0.05
330 0.05
331 0.05
332 0.06
333 0.05
334 0.05
335 0.08
336 0.09
337 0.09
338 0.1
339 0.11
340 0.11
341 0.14
342 0.15
343 0.16
344 0.17
345 0.17
346 0.16
347 0.18
348 0.18
349 0.17
350 0.21
351 0.17
352 0.16
353 0.16
354 0.16
355 0.13
356 0.13
357 0.12
358 0.07
359 0.08
360 0.08
361 0.08
362 0.1
363 0.11
364 0.12
365 0.13
366 0.12
367 0.12
368 0.2
369 0.2
370 0.17
371 0.16
372 0.16
373 0.14
374 0.15
375 0.16
376 0.09
377 0.12
378 0.12
379 0.13
380 0.13
381 0.13
382 0.12
383 0.1
384 0.11
385 0.08
386 0.08
387 0.07
388 0.09
389 0.08
390 0.09
391 0.1
392 0.12
393 0.2
394 0.23
395 0.23
396 0.22
397 0.23
398 0.24
399 0.28
400 0.34
401 0.35
402 0.39
403 0.44
404 0.44
405 0.43
406 0.42
407 0.38
408 0.31
409 0.25
410 0.19
411 0.15
412 0.16
413 0.19
414 0.22
415 0.25
416 0.24
417 0.22
418 0.24
419 0.22
420 0.24
421 0.29
422 0.26
423 0.22
424 0.25
425 0.24
426 0.23
427 0.24
428 0.21
429 0.13
430 0.17
431 0.19
432 0.21
433 0.23
434 0.22
435 0.23
436 0.26
437 0.29
438 0.31
439 0.38
440 0.38
441 0.41
442 0.47
443 0.48
444 0.49
445 0.53
446 0.5
447 0.51
448 0.51
449 0.51
450 0.47
451 0.47
452 0.51
453 0.5
454 0.5
455 0.46
456 0.43