Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YDI2

Protein Details
Accession A0A2C5YDI2    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
161-187SAVKRDELKRAMRKERRAKIKESNFLKHydrophilic
NLS Segment(s)
PositionSequence
113-116RQRR
167-181ELKRAMRKERRAKIK
Subcellular Location(s) mito 18.5, mito_nucl 12.999, cyto_mito 11.666, nucl 6, cyto_nucl 4.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFCSRCVRAATSTKGLALVRPFSVSSRLRLADPKLSTPITEAGETPQATTTVRSICREGTVLRGLNYLKGGQDPVALRDDDYPEWLWTCLDFKKSSANANDPDAVDEFSKSKRQRRLAAKAQKKTLADGTIEALEPKIPIQHQSINLPGSEGDSIEDKMASAVKRDELKRAMRKERRAKIKESNFLKSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.37
3 0.34
4 0.3
5 0.26
6 0.22
7 0.22
8 0.22
9 0.21
10 0.28
11 0.26
12 0.26
13 0.29
14 0.29
15 0.29
16 0.34
17 0.36
18 0.37
19 0.37
20 0.37
21 0.35
22 0.34
23 0.33
24 0.3
25 0.3
26 0.24
27 0.22
28 0.19
29 0.17
30 0.21
31 0.21
32 0.19
33 0.16
34 0.15
35 0.15
36 0.15
37 0.15
38 0.15
39 0.18
40 0.19
41 0.2
42 0.2
43 0.21
44 0.21
45 0.2
46 0.19
47 0.21
48 0.21
49 0.2
50 0.21
51 0.2
52 0.2
53 0.2
54 0.16
55 0.12
56 0.11
57 0.11
58 0.09
59 0.12
60 0.11
61 0.12
62 0.13
63 0.13
64 0.13
65 0.14
66 0.16
67 0.13
68 0.15
69 0.14
70 0.12
71 0.13
72 0.12
73 0.11
74 0.09
75 0.11
76 0.1
77 0.11
78 0.12
79 0.11
80 0.18
81 0.19
82 0.23
83 0.23
84 0.26
85 0.25
86 0.26
87 0.28
88 0.21
89 0.21
90 0.18
91 0.16
92 0.12
93 0.11
94 0.1
95 0.1
96 0.18
97 0.21
98 0.28
99 0.35
100 0.41
101 0.5
102 0.58
103 0.65
104 0.68
105 0.75
106 0.77
107 0.75
108 0.74
109 0.7
110 0.61
111 0.54
112 0.47
113 0.39
114 0.3
115 0.24
116 0.21
117 0.17
118 0.17
119 0.14
120 0.11
121 0.09
122 0.08
123 0.08
124 0.09
125 0.08
126 0.11
127 0.15
128 0.2
129 0.22
130 0.25
131 0.28
132 0.27
133 0.26
134 0.24
135 0.2
136 0.17
137 0.14
138 0.12
139 0.09
140 0.1
141 0.11
142 0.1
143 0.1
144 0.08
145 0.09
146 0.12
147 0.12
148 0.13
149 0.14
150 0.19
151 0.26
152 0.28
153 0.34
154 0.38
155 0.47
156 0.53
157 0.61
158 0.67
159 0.69
160 0.79
161 0.83
162 0.86
163 0.87
164 0.84
165 0.82
166 0.82
167 0.83
168 0.82
169 0.78