FuNGI

J3PBN1

Protein Details

Accession

J3PBN1

Localization Confidence

Low

Confidence Score

8.7

NoLS Segment(s)

Position	Sequence	Protein Nature
70-99	FAPRPSHHGATRKRRRRRSRHLRAVRLLLA	Basic

NLS Segment(s)

Position	Sequence
74-92	PSHHGATRKRRRRRSRHLR

Subcellular Location(s)

mito 19, cyto 4, nucl 2, pero 2

Family & Domain DBs

Amino Acid Sequences

MSQSTKARLGSFQNGSGAPKYAHPKREEPPQLKPLIAEILDSQDCISGSVFLVEKIDTVTQPIAAPRQIFAPRPSHHGATRKRRRRRSRHLRAVRLLLADGGGVCIQGLLRPAAHDLVYKGSVYEGCFVRLDDFWLRVVQPDASSPETRPTVFLVLEVVTPLSKPRPRPAVKQSTAADDELTTPQRRASVATLKPPAATAGQKQGLKQPFPVAGFLSAATIRDAPPVLAAAEAPDFGGPTDGGPRQHSHNSTSNQGHEKPASGAKAPGATVARRPQAPAEPDSSRLGTPPAWACHDLSHPLKLTPLRAIPLLPFKQNWMVNVLAVVAELSGPEPSLLPPSYAQRTARLADPSTPKHVLLTVFLDPDGFAPSPGAAVLLLGVKNHRFDGGSLKKYASDRPRDGGPWWLEAPRHLPWCDVAGLEAWWAAMAEEEKEEGRSRQEDG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.39
2	0.4
3	0.37
4	0.33
5	0.25
6	0.27
7	0.34
8	0.39
9	0.45
10	0.48
11	0.53
12	0.56
13	0.66
14	0.7
15	0.67
16	0.68
17	0.69
18	0.67
19	0.6
20	0.55
21	0.47
22	0.41
23	0.36
24	0.27
25	0.2
26	0.23
27	0.22
28	0.22
29	0.19
30	0.15
31	0.15
32	0.15
33	0.14
34	0.09
35	0.09
36	0.12
37	0.12
38	0.1
39	0.11
40	0.1
41	0.1
42	0.11
43	0.13
44	0.1
45	0.13
46	0.13
47	0.13
48	0.14
49	0.16
50	0.18
51	0.19
52	0.19
53	0.17
54	0.23
55	0.25
56	0.28
57	0.3
58	0.36
59	0.35
60	0.41
61	0.45
62	0.43
63	0.45
64	0.51
65	0.57
66	0.59
67	0.69
68	0.72
69	0.78
70	0.85
71	0.91
72	0.92
73	0.94
74	0.94
75	0.94
76	0.95
77	0.95
78	0.95
79	0.9
80	0.85
81	0.77
82	0.67
83	0.55
84	0.44
85	0.33
86	0.23
87	0.16
88	0.11
89	0.07
90	0.05
91	0.05
92	0.04
93	0.04
94	0.05
95	0.07
96	0.06
97	0.07
98	0.08
99	0.09
100	0.1
101	0.11
102	0.11
103	0.11
104	0.13
105	0.14
106	0.14
107	0.12
108	0.12
109	0.13
110	0.13
111	0.17
112	0.14
113	0.15
114	0.15
115	0.16
116	0.17
117	0.15
118	0.18
119	0.15
120	0.15
121	0.14
122	0.15
123	0.15
124	0.14
125	0.16
126	0.13
127	0.11
128	0.12
129	0.15
130	0.17
131	0.19
132	0.18
133	0.21
134	0.22
135	0.22
136	0.21
137	0.19
138	0.17
139	0.16
140	0.15
141	0.12
142	0.11
143	0.11
144	0.1
145	0.08
146	0.06
147	0.06
148	0.07
149	0.12
150	0.15
151	0.18
152	0.25
153	0.35
154	0.39
155	0.47
156	0.56
157	0.6
158	0.59
159	0.64
160	0.58
161	0.53
162	0.51
163	0.43
164	0.33
165	0.22
166	0.22
167	0.18
168	0.2
169	0.15
170	0.13
171	0.14
172	0.15
173	0.15
174	0.15
175	0.17
176	0.22
177	0.24
178	0.31
179	0.33
180	0.32
181	0.32
182	0.3
183	0.27
184	0.2
185	0.18
186	0.14
187	0.18
188	0.22
189	0.23
190	0.23
191	0.29
192	0.31
193	0.3
194	0.29
195	0.25
196	0.24
197	0.23
198	0.24
199	0.17
200	0.14
201	0.13
202	0.12
203	0.1
204	0.07
205	0.07
206	0.07
207	0.07
208	0.06
209	0.07
210	0.07
211	0.06
212	0.06
213	0.06
214	0.05
215	0.05
216	0.05
217	0.04
218	0.05
219	0.05
220	0.05
221	0.04
222	0.04
223	0.04
224	0.05
225	0.04
226	0.04
227	0.07
228	0.09
229	0.1
230	0.12
231	0.13
232	0.17
233	0.22
234	0.23
235	0.25
236	0.31
237	0.32
238	0.36
239	0.37
240	0.37
241	0.37
242	0.37
243	0.34
244	0.28
245	0.27
246	0.22
247	0.23
248	0.21
249	0.17
250	0.16
251	0.14
252	0.15
253	0.14
254	0.15
255	0.14
256	0.13
257	0.17
258	0.21
259	0.23
260	0.23
261	0.23
262	0.23
263	0.27
264	0.29
265	0.27
266	0.27
267	0.26
268	0.28
269	0.29
270	0.28
271	0.22
272	0.2
273	0.19
274	0.14
275	0.17
276	0.18
277	0.18
278	0.2
279	0.21
280	0.21
281	0.21
282	0.23
283	0.25
284	0.23
285	0.24
286	0.22
287	0.21
288	0.24
289	0.24
290	0.23
291	0.22
292	0.22
293	0.2
294	0.19
295	0.2
296	0.19
297	0.26
298	0.27
299	0.25
300	0.24
301	0.25
302	0.31
303	0.32
304	0.3
305	0.24
306	0.22
307	0.2
308	0.2
309	0.17
310	0.1
311	0.08
312	0.07
313	0.04
314	0.03
315	0.03
316	0.04
317	0.03
318	0.04
319	0.04
320	0.05
321	0.05
322	0.1
323	0.1
324	0.11
325	0.13
326	0.18
327	0.23
328	0.27
329	0.28
330	0.28
331	0.31
332	0.32
333	0.35
334	0.33
335	0.31
336	0.33
337	0.39
338	0.39
339	0.42
340	0.42
341	0.37
342	0.34
343	0.35
344	0.29
345	0.24
346	0.25
347	0.2
348	0.19
349	0.19
350	0.18
351	0.15
352	0.15
353	0.16
354	0.12
355	0.1
356	0.1
357	0.1
358	0.1
359	0.09
360	0.09
361	0.05
362	0.05
363	0.05
364	0.07
365	0.08
366	0.08
367	0.11
368	0.13
369	0.15
370	0.15
371	0.16
372	0.14
373	0.15
374	0.25
375	0.32
376	0.35
377	0.36
378	0.36
379	0.39
380	0.4
381	0.48
382	0.47
383	0.48
384	0.48
385	0.49
386	0.53
387	0.51
388	0.51
389	0.51
390	0.44
391	0.39
392	0.37
393	0.37
394	0.32
395	0.33
396	0.36
397	0.33
398	0.37
399	0.32
400	0.31
401	0.29
402	0.32
403	0.3
404	0.25
405	0.2
406	0.15
407	0.14
408	0.14
409	0.12
410	0.08
411	0.07
412	0.07
413	0.06
414	0.07
415	0.08
416	0.08
417	0.09
418	0.11
419	0.12
420	0.14
421	0.17
422	0.17
423	0.22

J3PBN1

3D AlphaFold-predicted Structure Viewer