Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PBN1

Protein Details
Accession J3PBN1   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
70-99FAPRPSHHGATRKRRRRRSRHLRAVRLLLABasic
NLS Segment(s)
PositionSequence
74-92PSHHGATRKRRRRRSRHLR
Subcellular Location(s) mito 19, cyto 4, nucl 2, pero 2
Family & Domain DBs
Amino Acid Sequences MSQSTKARLGSFQNGSGAPKYAHPKREEPPQLKPLIAEILDSQDCISGSVFLVEKIDTVTQPIAAPRQIFAPRPSHHGATRKRRRRRSRHLRAVRLLLADGGGVCIQGLLRPAAHDLVYKGSVYEGCFVRLDDFWLRVVQPDASSPETRPTVFLVLEVVTPLSKPRPRPAVKQSTAADDELTTPQRRASVATLKPPAATAGQKQGLKQPFPVAGFLSAATIRDAPPVLAAAEAPDFGGPTDGGPRQHSHNSTSNQGHEKPASGAKAPGATVARRPQAPAEPDSSRLGTPPAWACHDLSHPLKLTPLRAIPLLPFKQNWMVNVLAVVAELSGPEPSLLPPSYAQRTARLADPSTPKHVLLTVFLDPDGFAPSPGAAVLLLGVKNHRFDGGSLKKYASDRPRDGGPWWLEAPRHLPWCDVAGLEAWWAAMAEEEKEEGRSRQEDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.37
4 0.33
5 0.25
6 0.27
7 0.34
8 0.39
9 0.45
10 0.48
11 0.53
12 0.56
13 0.66
14 0.7
15 0.67
16 0.68
17 0.69
18 0.67
19 0.6
20 0.55
21 0.47
22 0.41
23 0.36
24 0.27
25 0.2
26 0.23
27 0.22
28 0.22
29 0.19
30 0.15
31 0.15
32 0.15
33 0.14
34 0.09
35 0.09
36 0.12
37 0.12
38 0.1
39 0.11
40 0.1
41 0.1
42 0.11
43 0.13
44 0.1
45 0.13
46 0.13
47 0.13
48 0.14
49 0.16
50 0.18
51 0.19
52 0.19
53 0.17
54 0.23
55 0.25
56 0.28
57 0.3
58 0.36
59 0.35
60 0.41
61 0.45
62 0.43
63 0.45
64 0.51
65 0.57
66 0.59
67 0.69
68 0.72
69 0.78
70 0.85
71 0.91
72 0.92
73 0.94
74 0.94
75 0.94
76 0.95
77 0.95
78 0.95
79 0.9
80 0.85
81 0.77
82 0.67
83 0.55
84 0.44
85 0.33
86 0.23
87 0.16
88 0.11
89 0.07
90 0.05
91 0.05
92 0.04
93 0.04
94 0.05
95 0.07
96 0.06
97 0.07
98 0.08
99 0.09
100 0.1
101 0.11
102 0.11
103 0.11
104 0.13
105 0.14
106 0.14
107 0.12
108 0.12
109 0.13
110 0.13
111 0.17
112 0.14
113 0.15
114 0.15
115 0.16
116 0.17
117 0.15
118 0.18
119 0.15
120 0.15
121 0.14
122 0.15
123 0.15
124 0.14
125 0.16
126 0.13
127 0.11
128 0.12
129 0.15
130 0.17
131 0.19
132 0.18
133 0.21
134 0.22
135 0.22
136 0.21
137 0.19
138 0.17
139 0.16
140 0.15
141 0.12
142 0.11
143 0.11
144 0.1
145 0.08
146 0.06
147 0.06
148 0.07
149 0.12
150 0.15
151 0.18
152 0.25
153 0.35
154 0.39
155 0.47
156 0.56
157 0.6
158 0.59
159 0.64
160 0.58
161 0.53
162 0.51
163 0.43
164 0.33
165 0.22
166 0.22
167 0.18
168 0.2
169 0.15
170 0.13
171 0.14
172 0.15
173 0.15
174 0.15
175 0.17
176 0.22
177 0.24
178 0.31
179 0.33
180 0.32
181 0.32
182 0.3
183 0.27
184 0.2
185 0.18
186 0.14
187 0.18
188 0.22
189 0.23
190 0.23
191 0.29
192 0.31
193 0.3
194 0.29
195 0.25
196 0.24
197 0.23
198 0.24
199 0.17
200 0.14
201 0.13
202 0.12
203 0.1
204 0.07
205 0.07
206 0.07
207 0.07
208 0.06
209 0.07
210 0.07
211 0.06
212 0.06
213 0.06
214 0.05
215 0.05
216 0.05
217 0.04
218 0.05
219 0.05
220 0.05
221 0.04
222 0.04
223 0.04
224 0.05
225 0.04
226 0.04
227 0.07
228 0.09
229 0.1
230 0.12
231 0.13
232 0.17
233 0.22
234 0.23
235 0.25
236 0.31
237 0.32
238 0.36
239 0.37
240 0.37
241 0.37
242 0.37
243 0.34
244 0.28
245 0.27
246 0.22
247 0.23
248 0.21
249 0.17
250 0.16
251 0.14
252 0.15
253 0.14
254 0.15
255 0.14
256 0.13
257 0.17
258 0.21
259 0.23
260 0.23
261 0.23
262 0.23
263 0.27
264 0.29
265 0.27
266 0.27
267 0.26
268 0.28
269 0.29
270 0.28
271 0.22
272 0.2
273 0.19
274 0.14
275 0.17
276 0.18
277 0.18
278 0.2
279 0.21
280 0.21
281 0.21
282 0.23
283 0.25
284 0.23
285 0.24
286 0.22
287 0.21
288 0.24
289 0.24
290 0.23
291 0.22
292 0.22
293 0.2
294 0.19
295 0.2
296 0.19
297 0.26
298 0.27
299 0.25
300 0.24
301 0.25
302 0.31
303 0.32
304 0.3
305 0.24
306 0.22
307 0.2
308 0.2
309 0.17
310 0.1
311 0.08
312 0.07
313 0.04
314 0.03
315 0.03
316 0.04
317 0.03
318 0.04
319 0.04
320 0.05
321 0.05
322 0.1
323 0.1
324 0.11
325 0.13
326 0.18
327 0.23
328 0.27
329 0.28
330 0.28
331 0.31
332 0.32
333 0.35
334 0.33
335 0.31
336 0.33
337 0.39
338 0.39
339 0.42
340 0.42
341 0.37
342 0.34
343 0.35
344 0.29
345 0.24
346 0.25
347 0.2
348 0.19
349 0.19
350 0.18
351 0.15
352 0.15
353 0.16
354 0.12
355 0.1
356 0.1
357 0.1
358 0.1
359 0.09
360 0.09
361 0.05
362 0.05
363 0.05
364 0.07
365 0.08
366 0.08
367 0.11
368 0.13
369 0.15
370 0.15
371 0.16
372 0.14
373 0.15
374 0.25
375 0.32
376 0.35
377 0.36
378 0.36
379 0.39
380 0.4
381 0.48
382 0.47
383 0.48
384 0.48
385 0.49
386 0.53
387 0.51
388 0.51
389 0.51
390 0.44
391 0.39
392 0.37
393 0.37
394 0.32
395 0.33
396 0.36
397 0.33
398 0.37
399 0.32
400 0.31
401 0.29
402 0.32
403 0.3
404 0.25
405 0.2
406 0.15
407 0.14
408 0.14
409 0.12
410 0.08
411 0.07
412 0.07
413 0.06
414 0.07
415 0.08
416 0.08
417 0.09
418 0.11
419 0.12
420 0.14
421 0.17
422 0.17
423 0.22