Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PAH2

Protein Details
Accession J3PAH2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
71-98GAPKHKSSTTARPEKKRRAERWTRIRLIHydrophilic
NLS Segment(s)
PositionSequence
80-94TARPEKKRRAERWTR
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MLCDVGVSSRRWVRKGQQPHLPAPASARTNIAKEAICTHMDVAYVTGGVGREKAEANMQVDSLVRTLCPTGAPKHKSSTTARPEKKRRAERWTRIRLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.59
3 0.61
4 0.63
5 0.64
6 0.67
7 0.68
8 0.6
9 0.51
10 0.44
11 0.42
12 0.34
13 0.3
14 0.29
15 0.23
16 0.24
17 0.24
18 0.23
19 0.17
20 0.16
21 0.18
22 0.17
23 0.16
24 0.15
25 0.14
26 0.12
27 0.12
28 0.11
29 0.09
30 0.06
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.06
40 0.07
41 0.08
42 0.1
43 0.11
44 0.11
45 0.11
46 0.1
47 0.1
48 0.1
49 0.09
50 0.07
51 0.06
52 0.06
53 0.06
54 0.06
55 0.08
56 0.1
57 0.16
58 0.26
59 0.3
60 0.33
61 0.39
62 0.41
63 0.44
64 0.48
65 0.52
66 0.53
67 0.6
68 0.66
69 0.7
70 0.78
71 0.83
72 0.88
73 0.88
74 0.86
75 0.86
76 0.89
77 0.89
78 0.9