Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5XY59

Protein Details
Accession A0A2C5XY59   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
81-124PLDLRPKKTRAIRRRLSPQDSARVLEKVKKRNSHFCQRKFAIKAHydrophilic
NLS Segment(s)
PositionSequence
81-98PLDLRPKKTRAIRRRLSP
Subcellular Location(s) nucl 19.5, mito_nucl 13.5, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSTSKVKTSQLWDKNKDDLLKQLVELKTELGQLRVQKVASSGTKLNRIHDLRKSIARVLTIVKSKQRAQLRLFYKNKKYAPLDLRPKKTRAIRRRLSPQDSARVLEKVKKRNSHFCQRKFAIKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.64
3 0.59
4 0.51
5 0.48
6 0.43
7 0.37
8 0.34
9 0.36
10 0.32
11 0.3
12 0.29
13 0.23
14 0.19
15 0.22
16 0.21
17 0.15
18 0.18
19 0.19
20 0.21
21 0.22
22 0.2
23 0.17
24 0.17
25 0.2
26 0.19
27 0.2
28 0.21
29 0.22
30 0.3
31 0.31
32 0.31
33 0.35
34 0.37
35 0.38
36 0.39
37 0.41
38 0.36
39 0.39
40 0.39
41 0.33
42 0.31
43 0.27
44 0.23
45 0.2
46 0.21
47 0.2
48 0.21
49 0.21
50 0.23
51 0.25
52 0.31
53 0.34
54 0.36
55 0.36
56 0.42
57 0.45
58 0.51
59 0.56
60 0.58
61 0.59
62 0.61
63 0.6
64 0.58
65 0.56
66 0.54
67 0.55
68 0.56
69 0.61
70 0.61
71 0.69
72 0.67
73 0.66
74 0.65
75 0.67
76 0.68
77 0.67
78 0.69
79 0.68
80 0.73
81 0.81
82 0.83
83 0.8
84 0.78
85 0.74
86 0.72
87 0.66
88 0.59
89 0.51
90 0.44
91 0.41
92 0.4
93 0.42
94 0.42
95 0.49
96 0.56
97 0.6
98 0.68
99 0.75
100 0.79
101 0.82
102 0.8
103 0.82
104 0.78
105 0.8