Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YB98

Protein Details
Accession A0A2C5YB98   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-36LKRPSAEPSKPFKRPKTEKRFRPDAKLTTHydrophilic
NLS Segment(s)
PositionSequence
11-29PSAEPSKPFKRPKTEKRFR
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 4
Family & Domain DBs
Amino Acid Sequences MPHGESSLKRPSAEPSKPFKRPKTEKRFRPDAKLTTSTSPSHSPCHICHRRPNNKASLDAFADCQGCGQRTCFVCVRECHGWAVPDEDEAAAAEEEEEQEQEKEKPWLRGPEAVCLDAGHRAVVCSRCCVEMGSQGDVMCLGCLCSAPGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.54
3 0.61
4 0.7
5 0.78
6 0.78
7 0.79
8 0.81
9 0.85
10 0.86
11 0.88
12 0.88
13 0.88
14 0.9
15 0.84
16 0.83
17 0.8
18 0.76
19 0.72
20 0.67
21 0.61
22 0.55
23 0.54
24 0.45
25 0.4
26 0.39
27 0.33
28 0.32
29 0.32
30 0.31
31 0.3
32 0.4
33 0.45
34 0.45
35 0.52
36 0.6
37 0.67
38 0.7
39 0.73
40 0.71
41 0.65
42 0.64
43 0.56
44 0.48
45 0.4
46 0.34
47 0.28
48 0.21
49 0.19
50 0.15
51 0.13
52 0.11
53 0.1
54 0.1
55 0.1
56 0.13
57 0.13
58 0.17
59 0.19
60 0.19
61 0.22
62 0.22
63 0.27
64 0.24
65 0.24
66 0.22
67 0.21
68 0.2
69 0.17
70 0.19
71 0.13
72 0.11
73 0.11
74 0.09
75 0.08
76 0.07
77 0.08
78 0.05
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.07
88 0.08
89 0.1
90 0.16
91 0.19
92 0.24
93 0.28
94 0.35
95 0.36
96 0.43
97 0.42
98 0.44
99 0.43
100 0.39
101 0.34
102 0.27
103 0.25
104 0.21
105 0.2
106 0.12
107 0.09
108 0.1
109 0.14
110 0.19
111 0.19
112 0.2
113 0.21
114 0.22
115 0.22
116 0.23
117 0.21
118 0.24
119 0.26
120 0.25
121 0.25
122 0.24
123 0.24
124 0.23
125 0.2
126 0.13
127 0.09
128 0.07
129 0.06
130 0.06