Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8QN83

Protein Details
Accession J8QN83    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
96-122ELKKIPKTIKKIPKTIKNKFNQLKDKLHydrophilic
NLS Segment(s)
PositionSequence
98-129KKIPKTIKKIPKTIKNKFNQLKDKLKGGKKGA
Subcellular Location(s) extr 18, E.R. 4, mito 2, plas 1, pero 1, golg 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
Amino Acid Sequences MFVKNILVFLPLILSGAVALPAPKTDAVFGLSTRSLPDVPVARVVLPRAVNYPVPMVKPRHSTVPAKVSQLAARDDAAVEALTLRSELETRGLLDELKKIPKTIKKIPKTIKNKFNQLKDKLKGGKKGAAPATPAEPTTPAEPATP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.06
5 0.05
6 0.05
7 0.05
8 0.05
9 0.07
10 0.08
11 0.08
12 0.08
13 0.09
14 0.11
15 0.12
16 0.12
17 0.14
18 0.13
19 0.13
20 0.13
21 0.14
22 0.12
23 0.12
24 0.15
25 0.15
26 0.16
27 0.19
28 0.18
29 0.17
30 0.18
31 0.19
32 0.19
33 0.16
34 0.16
35 0.15
36 0.17
37 0.16
38 0.16
39 0.19
40 0.16
41 0.17
42 0.21
43 0.22
44 0.24
45 0.29
46 0.29
47 0.32
48 0.34
49 0.35
50 0.36
51 0.4
52 0.38
53 0.35
54 0.35
55 0.3
56 0.28
57 0.27
58 0.23
59 0.16
60 0.14
61 0.12
62 0.11
63 0.1
64 0.08
65 0.06
66 0.04
67 0.04
68 0.04
69 0.03
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.06
76 0.06
77 0.07
78 0.08
79 0.08
80 0.09
81 0.09
82 0.13
83 0.15
84 0.2
85 0.2
86 0.2
87 0.26
88 0.32
89 0.38
90 0.45
91 0.52
92 0.54
93 0.64
94 0.72
95 0.76
96 0.8
97 0.82
98 0.82
99 0.79
100 0.83
101 0.81
102 0.82
103 0.81
104 0.79
105 0.79
106 0.73
107 0.74
108 0.73
109 0.71
110 0.7
111 0.65
112 0.64
113 0.57
114 0.62
115 0.58
116 0.51
117 0.47
118 0.41
119 0.4
120 0.35
121 0.32
122 0.25
123 0.22
124 0.22
125 0.22
126 0.21