Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5XWE8

Protein Details
Accession A0A2C5XWE8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
31-55REGTKAGVRKKRSKKAKTNKADVVAHydrophilic
NLS Segment(s)
PositionSequence
28-50KRRREGTKAGVRKKRSKKAKTNK
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MTREGTRSQTGHSRPRVFLVPDTAPVQKRRREGTKAGVRKKRSKKAKTNKADVVATKTAKTAAKMTRVRLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.54
4 0.47
5 0.43
6 0.39
7 0.32
8 0.29
9 0.31
10 0.31
11 0.29
12 0.34
13 0.37
14 0.36
15 0.4
16 0.43
17 0.47
18 0.49
19 0.5
20 0.54
21 0.57
22 0.61
23 0.65
24 0.67
25 0.66
26 0.71
27 0.76
28 0.76
29 0.77
30 0.78
31 0.8
32 0.84
33 0.89
34 0.88
35 0.87
36 0.84
37 0.78
38 0.72
39 0.63
40 0.59
41 0.54
42 0.46
43 0.38
44 0.32
45 0.3
46 0.28
47 0.28
48 0.29
49 0.28
50 0.37
51 0.41