Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5Y1F7

Protein Details
Accession A0A2C5Y1F7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
87-107DENRGRERTRRHDRQSATKSGBasic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 7.5, cyto_mito 6.5, extr 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAPKTSEAVYCLVPNLRALDTSARELDLASHSWVQPIVIDDDDLMFGGKPLSAWYEEDRRRLSSGSDDGDAVDNDNDVDQHSHSADDENRGRERTRRHDRQSATKSGHHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.16
4 0.15
5 0.16
6 0.19
7 0.2
8 0.23
9 0.22
10 0.19
11 0.19
12 0.18
13 0.18
14 0.14
15 0.13
16 0.13
17 0.14
18 0.13
19 0.14
20 0.14
21 0.12
22 0.11
23 0.11
24 0.1
25 0.08
26 0.08
27 0.08
28 0.08
29 0.08
30 0.07
31 0.06
32 0.04
33 0.04
34 0.04
35 0.04
36 0.03
37 0.04
38 0.05
39 0.06
40 0.07
41 0.1
42 0.19
43 0.21
44 0.25
45 0.26
46 0.26
47 0.27
48 0.26
49 0.24
50 0.2
51 0.21
52 0.19
53 0.18
54 0.16
55 0.16
56 0.17
57 0.15
58 0.12
59 0.09
60 0.07
61 0.06
62 0.06
63 0.06
64 0.06
65 0.07
66 0.06
67 0.08
68 0.08
69 0.09
70 0.09
71 0.13
72 0.14
73 0.2
74 0.24
75 0.27
76 0.3
77 0.32
78 0.34
79 0.36
80 0.44
81 0.47
82 0.54
83 0.6
84 0.66
85 0.73
86 0.77
87 0.83
88 0.81
89 0.8
90 0.74