Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5XV56

Protein Details
Accession A0A2C5XV56   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
72-97SEGFCPRTTMHRKKKKYDYTRSSVASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
Amino Acid Sequences MGEAGEAEVTSRKPRAGSDCRQPQLRAGPPSQIAGPGFGLRGVLYCRPAASDGGAGRCSAMVALVVRRCPGSEGFCPRTTMHRKKKKYDYTRSSVASLVSQAASSGTFAPLSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.31
3 0.37
4 0.43
5 0.5
6 0.58
7 0.62
8 0.66
9 0.62
10 0.58
11 0.58
12 0.57
13 0.52
14 0.43
15 0.42
16 0.39
17 0.39
18 0.34
19 0.28
20 0.21
21 0.17
22 0.16
23 0.12
24 0.11
25 0.09
26 0.09
27 0.07
28 0.07
29 0.08
30 0.09
31 0.1
32 0.1
33 0.1
34 0.1
35 0.11
36 0.11
37 0.09
38 0.11
39 0.1
40 0.12
41 0.12
42 0.11
43 0.1
44 0.1
45 0.09
46 0.06
47 0.05
48 0.04
49 0.04
50 0.07
51 0.08
52 0.09
53 0.09
54 0.1
55 0.1
56 0.11
57 0.12
58 0.15
59 0.19
60 0.27
61 0.32
62 0.33
63 0.36
64 0.35
65 0.42
66 0.48
67 0.53
68 0.55
69 0.61
70 0.68
71 0.75
72 0.85
73 0.87
74 0.87
75 0.88
76 0.86
77 0.83
78 0.82
79 0.75
80 0.66
81 0.56
82 0.47
83 0.37
84 0.28
85 0.23
86 0.15
87 0.12
88 0.11
89 0.1
90 0.09
91 0.09
92 0.09
93 0.08