Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5XPS5

Protein Details
Accession A0A2C5XPS5   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPSISKPCHNCRRRRLRCDRSWPSCHKCAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MPSISKPCHNCRRRRLRCDRSWPSCHKCAGSGQECLGYGRVFVWAQTLHAHGVLKAQAQPQAASVALPACPSLKAPRCKSSEPYQRPACTWP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.91
4 0.92
5 0.94
6 0.93
7 0.9
8 0.88
9 0.87
10 0.83
11 0.77
12 0.7
13 0.6
14 0.51
15 0.47
16 0.47
17 0.4
18 0.35
19 0.3
20 0.28
21 0.28
22 0.26
23 0.22
24 0.13
25 0.1
26 0.08
27 0.09
28 0.08
29 0.07
30 0.08
31 0.07
32 0.08
33 0.09
34 0.1
35 0.08
36 0.09
37 0.09
38 0.07
39 0.09
40 0.09
41 0.09
42 0.1
43 0.12
44 0.13
45 0.14
46 0.14
47 0.13
48 0.14
49 0.13
50 0.11
51 0.1
52 0.08
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.09
59 0.18
60 0.25
61 0.35
62 0.41
63 0.49
64 0.54
65 0.59
66 0.63
67 0.65
68 0.68
69 0.66
70 0.7
71 0.7
72 0.67