Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YEZ7

Protein Details
Accession A0A2C5YEZ7   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAAPRHRRIGRRRRVEDEADDBasic
NLS Segment(s)
PositionSequence
6-13HRRIGRRR
198-202GRGGR
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018545  Btz_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0035145  C:exon-exon junction complex  
GO:0003729  F:mRNA binding  
GO:0006397  P:mRNA processing  
GO:0051028  P:mRNA transport  
GO:0000184  P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay  
GO:0006417  P:regulation of translation  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF09405  Btz  
Amino Acid Sequences MAAPRHRRIGRRRRVEDEADDESRTEALDVDDESQSDGSTLTDDEAADEDSDTSNIDEASPTSPLAARRAANGAPKSAADRQTPSRPATGAKPGSDTDMMLHGLTSDHSTVPTADLHQPASAASPSKSHSAPVVVSSASASRPAPSLSQVDRRRQEHEDYKRRRDQDPSFVPNRGAFFMHDHRHAGPAANGFRPFGRGRGGRGGARGGIGGPFSPYNQMFQSSDPTTSSPWTHDMHDAVADHVPRRPRHLVQTEGPPNGNGFIPRCELSSTPINRTLSTEKHIGNAQVRVFLPQLMKSPTVIPGVPVKQYTKLPDHRPPLRRDKPVRISLPRHAPRYIFPAADRSFTFIPRAMRPSQQRMRGKPRSTWGSVGGFSRRTSVFGGSFYGSACSPSIALSRRSSVANEQDMVFSPTGSAISHGPTSADVARPIVRLPPAPVVRPDAMMPGALANPVPQSEVPMAVQEPNMMDEAPQPPSHMYPAGPSIEQIRPPSLPMHQPRPQKNISVADIESPAMNQGPRTLQQPFHQQVPVQVANGVPPEPHAHVRGPSYQSHHSTGTPLSQIPERAIHAAPFQPNSFGPSQFYAQHVFQPQTQPPPPPPPPPHSQTQQGYYFAGYSAPTMAPSATAPPFIPGGQHGGAGAASFTSHQGRDEPPASQGSLVAQEVNGMVYYYEASQLQPINGYPPYSAPQNFQPSVMGMGGMVTPSPDGFYYPQPAPGMVYYSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.77
4 0.73
5 0.69
6 0.6
7 0.53
8 0.46
9 0.38
10 0.31
11 0.24
12 0.17
13 0.11
14 0.09
15 0.1
16 0.11
17 0.13
18 0.14
19 0.14
20 0.15
21 0.14
22 0.13
23 0.11
24 0.1
25 0.07
26 0.08
27 0.08
28 0.08
29 0.09
30 0.09
31 0.1
32 0.11
33 0.12
34 0.11
35 0.11
36 0.1
37 0.1
38 0.1
39 0.1
40 0.09
41 0.09
42 0.09
43 0.09
44 0.08
45 0.09
46 0.11
47 0.11
48 0.11
49 0.12
50 0.14
51 0.16
52 0.19
53 0.23
54 0.22
55 0.23
56 0.28
57 0.3
58 0.35
59 0.35
60 0.34
61 0.3
62 0.31
63 0.33
64 0.35
65 0.38
66 0.33
67 0.37
68 0.41
69 0.49
70 0.53
71 0.51
72 0.47
73 0.43
74 0.42
75 0.42
76 0.45
77 0.41
78 0.37
79 0.38
80 0.35
81 0.38
82 0.36
83 0.3
84 0.22
85 0.2
86 0.19
87 0.15
88 0.15
89 0.1
90 0.1
91 0.1
92 0.11
93 0.1
94 0.09
95 0.1
96 0.11
97 0.11
98 0.12
99 0.13
100 0.14
101 0.18
102 0.19
103 0.2
104 0.19
105 0.19
106 0.17
107 0.19
108 0.17
109 0.15
110 0.13
111 0.15
112 0.17
113 0.21
114 0.21
115 0.19
116 0.19
117 0.2
118 0.2
119 0.19
120 0.19
121 0.15
122 0.15
123 0.15
124 0.14
125 0.12
126 0.13
127 0.12
128 0.11
129 0.12
130 0.13
131 0.14
132 0.15
133 0.21
134 0.23
135 0.33
136 0.39
137 0.47
138 0.54
139 0.55
140 0.57
141 0.56
142 0.6
143 0.6
144 0.65
145 0.66
146 0.68
147 0.75
148 0.78
149 0.77
150 0.72
151 0.71
152 0.67
153 0.67
154 0.67
155 0.65
156 0.61
157 0.59
158 0.56
159 0.5
160 0.45
161 0.35
162 0.27
163 0.2
164 0.22
165 0.28
166 0.3
167 0.3
168 0.3
169 0.29
170 0.31
171 0.3
172 0.26
173 0.21
174 0.23
175 0.24
176 0.25
177 0.25
178 0.23
179 0.23
180 0.26
181 0.23
182 0.19
183 0.23
184 0.22
185 0.25
186 0.33
187 0.36
188 0.33
189 0.34
190 0.34
191 0.27
192 0.26
193 0.22
194 0.14
195 0.11
196 0.1
197 0.08
198 0.08
199 0.08
200 0.08
201 0.12
202 0.12
203 0.13
204 0.14
205 0.16
206 0.16
207 0.16
208 0.22
209 0.2
210 0.2
211 0.19
212 0.2
213 0.18
214 0.2
215 0.19
216 0.16
217 0.18
218 0.18
219 0.19
220 0.21
221 0.2
222 0.18
223 0.19
224 0.17
225 0.15
226 0.15
227 0.14
228 0.13
229 0.15
230 0.21
231 0.2
232 0.26
233 0.3
234 0.31
235 0.39
236 0.45
237 0.47
238 0.45
239 0.55
240 0.54
241 0.5
242 0.47
243 0.38
244 0.32
245 0.28
246 0.24
247 0.16
248 0.12
249 0.12
250 0.14
251 0.14
252 0.14
253 0.15
254 0.15
255 0.17
256 0.24
257 0.25
258 0.26
259 0.31
260 0.31
261 0.3
262 0.34
263 0.34
264 0.28
265 0.29
266 0.3
267 0.24
268 0.25
269 0.27
270 0.26
271 0.24
272 0.26
273 0.23
274 0.22
275 0.21
276 0.21
277 0.2
278 0.19
279 0.18
280 0.15
281 0.18
282 0.17
283 0.17
284 0.16
285 0.17
286 0.17
287 0.18
288 0.16
289 0.14
290 0.17
291 0.18
292 0.19
293 0.19
294 0.18
295 0.19
296 0.21
297 0.24
298 0.27
299 0.32
300 0.37
301 0.43
302 0.5
303 0.56
304 0.61
305 0.63
306 0.67
307 0.68
308 0.71
309 0.7
310 0.72
311 0.71
312 0.72
313 0.73
314 0.69
315 0.65
316 0.62
317 0.66
318 0.62
319 0.57
320 0.5
321 0.45
322 0.39
323 0.4
324 0.36
325 0.26
326 0.21
327 0.25
328 0.24
329 0.25
330 0.24
331 0.21
332 0.2
333 0.19
334 0.2
335 0.16
336 0.18
337 0.18
338 0.22
339 0.21
340 0.26
341 0.3
342 0.38
343 0.41
344 0.48
345 0.52
346 0.55
347 0.64
348 0.67
349 0.65
350 0.6
351 0.6
352 0.57
353 0.52
354 0.47
355 0.4
356 0.33
357 0.31
358 0.29
359 0.24
360 0.2
361 0.18
362 0.19
363 0.15
364 0.15
365 0.15
366 0.15
367 0.13
368 0.12
369 0.14
370 0.12
371 0.12
372 0.11
373 0.1
374 0.08
375 0.08
376 0.08
377 0.06
378 0.06
379 0.06
380 0.09
381 0.11
382 0.14
383 0.14
384 0.16
385 0.17
386 0.18
387 0.18
388 0.19
389 0.22
390 0.21
391 0.2
392 0.19
393 0.18
394 0.18
395 0.19
396 0.15
397 0.1
398 0.08
399 0.07
400 0.07
401 0.07
402 0.07
403 0.05
404 0.07
405 0.07
406 0.07
407 0.07
408 0.07
409 0.09
410 0.09
411 0.1
412 0.09
413 0.1
414 0.11
415 0.12
416 0.12
417 0.12
418 0.12
419 0.12
420 0.14
421 0.2
422 0.21
423 0.22
424 0.23
425 0.25
426 0.24
427 0.24
428 0.22
429 0.16
430 0.15
431 0.13
432 0.12
433 0.08
434 0.08
435 0.07
436 0.06
437 0.05
438 0.05
439 0.06
440 0.07
441 0.06
442 0.08
443 0.08
444 0.1
445 0.09
446 0.1
447 0.1
448 0.1
449 0.11
450 0.09
451 0.08
452 0.08
453 0.09
454 0.07
455 0.07
456 0.09
457 0.11
458 0.13
459 0.13
460 0.13
461 0.13
462 0.14
463 0.16
464 0.14
465 0.12
466 0.11
467 0.15
468 0.15
469 0.14
470 0.14
471 0.17
472 0.18
473 0.21
474 0.21
475 0.2
476 0.18
477 0.2
478 0.22
479 0.2
480 0.26
481 0.3
482 0.37
483 0.41
484 0.49
485 0.55
486 0.6
487 0.59
488 0.54
489 0.54
490 0.51
491 0.47
492 0.41
493 0.35
494 0.29
495 0.28
496 0.24
497 0.19
498 0.13
499 0.11
500 0.09
501 0.09
502 0.07
503 0.09
504 0.11
505 0.13
506 0.16
507 0.19
508 0.21
509 0.25
510 0.35
511 0.35
512 0.36
513 0.36
514 0.33
515 0.34
516 0.38
517 0.35
518 0.25
519 0.24
520 0.2
521 0.2
522 0.21
523 0.17
524 0.09
525 0.1
526 0.12
527 0.15
528 0.17
529 0.18
530 0.19
531 0.21
532 0.25
533 0.3
534 0.3
535 0.31
536 0.34
537 0.38
538 0.39
539 0.4
540 0.39
541 0.33
542 0.32
543 0.3
544 0.28
545 0.23
546 0.2
547 0.19
548 0.2
549 0.2
550 0.19
551 0.21
552 0.19
553 0.2
554 0.2
555 0.19
556 0.19
557 0.23
558 0.24
559 0.24
560 0.23
561 0.22
562 0.21
563 0.25
564 0.24
565 0.21
566 0.2
567 0.21
568 0.23
569 0.22
570 0.24
571 0.24
572 0.23
573 0.27
574 0.28
575 0.27
576 0.28
577 0.32
578 0.34
579 0.38
580 0.41
581 0.4
582 0.42
583 0.5
584 0.52
585 0.55
586 0.58
587 0.56
588 0.6
589 0.6
590 0.61
591 0.57
592 0.61
593 0.55
594 0.56
595 0.54
596 0.48
597 0.45
598 0.38
599 0.33
600 0.24
601 0.2
602 0.14
603 0.1
604 0.11
605 0.1
606 0.1
607 0.1
608 0.1
609 0.09
610 0.1
611 0.14
612 0.13
613 0.14
614 0.14
615 0.15
616 0.16
617 0.15
618 0.16
619 0.12
620 0.17
621 0.16
622 0.16
623 0.14
624 0.13
625 0.13
626 0.12
627 0.11
628 0.05
629 0.05
630 0.05
631 0.08
632 0.1
633 0.11
634 0.12
635 0.16
636 0.18
637 0.25
638 0.27
639 0.25
640 0.26
641 0.28
642 0.27
643 0.24
644 0.22
645 0.17
646 0.18
647 0.17
648 0.15
649 0.12
650 0.12
651 0.12
652 0.12
653 0.1
654 0.07
655 0.06
656 0.06
657 0.07
658 0.07
659 0.09
660 0.09
661 0.09
662 0.13
663 0.15
664 0.15
665 0.16
666 0.16
667 0.18
668 0.2
669 0.2
670 0.17
671 0.19
672 0.21
673 0.26
674 0.27
675 0.26
676 0.33
677 0.41
678 0.41
679 0.39
680 0.37
681 0.32
682 0.33
683 0.29
684 0.21
685 0.11
686 0.12
687 0.11
688 0.1
689 0.08
690 0.06
691 0.06
692 0.06
693 0.08
694 0.07
695 0.1
696 0.13
697 0.17
698 0.23
699 0.24
700 0.29
701 0.28
702 0.28
703 0.28
704 0.27