Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5Y7J8

Protein Details
Accession A0A2C5Y7J8   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRMSKFQKRRQRERLRAVDDVHydrophilic
77-108DKYTLFDRKAKKYRKGLHKLPKWTKVSQRINPHydrophilic
NLS Segment(s)
PositionSequence
84-98RKAKKYRKGLHKLPK
Subcellular Location(s) mito 18.5, mito_nucl 12.333, nucl 5, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRITNPLSGGLLWKIPWRMSKFQKRRQRERLRAVDDVVATLETALKRNGHGPIGSLQKWKAEMPTEPEMLPRDKYTLFDRKAKKYRKGLHKLPKWTKVSQRINPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.26
8 0.3
9 0.38
10 0.47
11 0.57
12 0.64
13 0.72
14 0.8
15 0.83
16 0.87
17 0.9
18 0.91
19 0.9
20 0.9
21 0.9
22 0.85
23 0.77
24 0.68
25 0.59
26 0.48
27 0.37
28 0.27
29 0.17
30 0.11
31 0.09
32 0.09
33 0.06
34 0.07
35 0.08
36 0.08
37 0.09
38 0.11
39 0.13
40 0.12
41 0.12
42 0.12
43 0.15
44 0.2
45 0.2
46 0.2
47 0.19
48 0.19
49 0.2
50 0.19
51 0.17
52 0.14
53 0.15
54 0.19
55 0.23
56 0.23
57 0.22
58 0.23
59 0.24
60 0.24
61 0.24
62 0.18
63 0.17
64 0.16
65 0.19
66 0.24
67 0.31
68 0.33
69 0.4
70 0.46
71 0.53
72 0.63
73 0.69
74 0.72
75 0.73
76 0.79
77 0.82
78 0.85
79 0.85
80 0.87
81 0.87
82 0.88
83 0.88
84 0.87
85 0.82
86 0.8
87 0.79
88 0.79
89 0.8
90 0.77
91 0.78