Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5X890

Protein Details
Accession A0A2C5X890    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
208-228EALRARVPRKRKEADRIRVELBasic
NLS Segment(s)
PositionSequence
215-219PRKRK
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037475  Sos7  
Gene Ontology GO:0000776  C:kinetochore  
GO:0034501  P:protein localization to kinetochore  
Amino Acid Sequences MATDDTVDALAILKNQQSNNLLSIIKLRDQAACSAPLDSRQRASDASNDALDRLTPSSLEADLTHYAELFAKLRFSYVEQVTKEKFIRAIVGEPPLIVTVQENLDLERANVEAKSQLKALKLQVAEMVTELEIKGRQLSQRYERVRLEITRLEEIPAKIEEFKAQIKELKTARERKEINPDFGLPLAQTRVLVTSRKEEQQELAHQLEALRARVPRKRKEADRIRVELQPLEMKRQTSTTAARDAQKRKEAALGGVADDLEQRARWWRANEKVLEQVLDIRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.23
4 0.24
5 0.26
6 0.27
7 0.28
8 0.25
9 0.21
10 0.27
11 0.25
12 0.25
13 0.26
14 0.25
15 0.26
16 0.27
17 0.31
18 0.27
19 0.27
20 0.24
21 0.23
22 0.23
23 0.26
24 0.3
25 0.29
26 0.3
27 0.28
28 0.3
29 0.3
30 0.31
31 0.3
32 0.28
33 0.28
34 0.27
35 0.25
36 0.24
37 0.22
38 0.21
39 0.16
40 0.13
41 0.11
42 0.09
43 0.1
44 0.11
45 0.11
46 0.12
47 0.1
48 0.13
49 0.14
50 0.15
51 0.14
52 0.12
53 0.12
54 0.12
55 0.14
56 0.11
57 0.1
58 0.1
59 0.1
60 0.11
61 0.11
62 0.13
63 0.18
64 0.2
65 0.26
66 0.26
67 0.31
68 0.32
69 0.36
70 0.34
71 0.29
72 0.26
73 0.2
74 0.22
75 0.18
76 0.2
77 0.17
78 0.19
79 0.18
80 0.16
81 0.16
82 0.13
83 0.12
84 0.09
85 0.07
86 0.06
87 0.07
88 0.08
89 0.08
90 0.08
91 0.09
92 0.09
93 0.08
94 0.07
95 0.07
96 0.06
97 0.06
98 0.06
99 0.09
100 0.1
101 0.11
102 0.12
103 0.14
104 0.15
105 0.18
106 0.19
107 0.2
108 0.19
109 0.18
110 0.19
111 0.17
112 0.16
113 0.13
114 0.12
115 0.07
116 0.07
117 0.06
118 0.05
119 0.05
120 0.05
121 0.06
122 0.07
123 0.09
124 0.12
125 0.17
126 0.22
127 0.3
128 0.33
129 0.37
130 0.37
131 0.37
132 0.36
133 0.33
134 0.31
135 0.26
136 0.26
137 0.22
138 0.22
139 0.21
140 0.21
141 0.2
142 0.18
143 0.15
144 0.13
145 0.12
146 0.12
147 0.12
148 0.11
149 0.14
150 0.13
151 0.14
152 0.17
153 0.18
154 0.24
155 0.24
156 0.29
157 0.34
158 0.42
159 0.45
160 0.5
161 0.52
162 0.49
163 0.59
164 0.56
165 0.53
166 0.46
167 0.42
168 0.34
169 0.32
170 0.28
171 0.17
172 0.14
173 0.11
174 0.09
175 0.08
176 0.07
177 0.09
178 0.11
179 0.13
180 0.14
181 0.18
182 0.22
183 0.26
184 0.27
185 0.26
186 0.28
187 0.3
188 0.34
189 0.33
190 0.31
191 0.27
192 0.25
193 0.24
194 0.24
195 0.21
196 0.17
197 0.15
198 0.16
199 0.21
200 0.28
201 0.36
202 0.42
203 0.49
204 0.57
205 0.63
206 0.71
207 0.77
208 0.81
209 0.81
210 0.78
211 0.72
212 0.66
213 0.6
214 0.5
215 0.43
216 0.4
217 0.32
218 0.34
219 0.34
220 0.31
221 0.31
222 0.31
223 0.31
224 0.28
225 0.33
226 0.29
227 0.34
228 0.37
229 0.42
230 0.48
231 0.53
232 0.56
233 0.58
234 0.55
235 0.5
236 0.51
237 0.47
238 0.4
239 0.38
240 0.31
241 0.24
242 0.23
243 0.22
244 0.16
245 0.15
246 0.14
247 0.1
248 0.09
249 0.09
250 0.17
251 0.21
252 0.26
253 0.32
254 0.41
255 0.48
256 0.57
257 0.6
258 0.56
259 0.61
260 0.57
261 0.52
262 0.43