Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PHK6

Protein Details
Accession J3PHK6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
8-39GTLVRRHGQDRQRRRRSGPPGRHRRVRGDQLGBasic
82-107DGRRRALRLARRRRGAHRQRGTRTTSBasic
NLS Segment(s)
PositionSequence
16-34QDRQRRRRSGPPGRHRRVR
64-101GARPLRRKGGRRGEPQDHDGRRRALRLARRRRGAHRQR
Subcellular Location(s) mito 12, cyto 8, extr 6, mito_nucl 6
Family & Domain DBs
Amino Acid Sequences MSLSYILGTLVRRHGQDRQRRRRSGPPGRHRRVRGDQLGGAHPQHQLPVPPVPDGVSVRHLAAGARPLRRKGGRRGEPQDHDGRRRALRLARRRRGAHRQRGTRTTSSTASWPCGTAKHCLIEKPAALCFRDIDRLVAAEKEAAAAATTNNKVVAPRVFVLDAVEEVGSMDRVTLGTHDLSAMREMLGMPVGVAGATLTLPGVFCVLFDYGRFGVTYESGLNGVPDLDAHIEVYSADKIVRVEFDSPYVKGLPTTMAVRERAPGADGGFQERRVRRTYTDAYTLELQELYRCVVEGREVKTSAADARKDIELFQMILRAEAAKLQGSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.45
3 0.54
4 0.62
5 0.67
6 0.74
7 0.8
8 0.83
9 0.84
10 0.86
11 0.86
12 0.86
13 0.86
14 0.86
15 0.88
16 0.91
17 0.87
18 0.85
19 0.84
20 0.83
21 0.8
22 0.74
23 0.68
24 0.63
25 0.61
26 0.54
27 0.45
28 0.37
29 0.31
30 0.25
31 0.24
32 0.21
33 0.2
34 0.2
35 0.25
36 0.24
37 0.23
38 0.23
39 0.22
40 0.24
41 0.24
42 0.23
43 0.2
44 0.19
45 0.19
46 0.19
47 0.18
48 0.15
49 0.15
50 0.2
51 0.22
52 0.28
53 0.32
54 0.33
55 0.41
56 0.48
57 0.53
58 0.56
59 0.62
60 0.65
61 0.71
62 0.77
63 0.78
64 0.76
65 0.75
66 0.74
67 0.7
68 0.65
69 0.6
70 0.57
71 0.51
72 0.49
73 0.48
74 0.45
75 0.49
76 0.54
77 0.61
78 0.64
79 0.69
80 0.73
81 0.76
82 0.8
83 0.81
84 0.81
85 0.8
86 0.8
87 0.79
88 0.8
89 0.78
90 0.71
91 0.64
92 0.57
93 0.49
94 0.41
95 0.39
96 0.33
97 0.3
98 0.26
99 0.23
100 0.2
101 0.21
102 0.22
103 0.21
104 0.21
105 0.23
106 0.24
107 0.24
108 0.26
109 0.26
110 0.26
111 0.23
112 0.24
113 0.22
114 0.21
115 0.2
116 0.18
117 0.17
118 0.19
119 0.18
120 0.15
121 0.13
122 0.13
123 0.13
124 0.12
125 0.11
126 0.07
127 0.07
128 0.06
129 0.05
130 0.04
131 0.04
132 0.04
133 0.04
134 0.08
135 0.08
136 0.08
137 0.08
138 0.09
139 0.09
140 0.11
141 0.11
142 0.1
143 0.1
144 0.11
145 0.11
146 0.11
147 0.11
148 0.09
149 0.08
150 0.06
151 0.06
152 0.04
153 0.04
154 0.04
155 0.04
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.04
162 0.05
163 0.05
164 0.05
165 0.06
166 0.06
167 0.07
168 0.07
169 0.07
170 0.05
171 0.06
172 0.06
173 0.05
174 0.05
175 0.05
176 0.04
177 0.04
178 0.04
179 0.03
180 0.03
181 0.02
182 0.02
183 0.02
184 0.02
185 0.02
186 0.02
187 0.03
188 0.03
189 0.04
190 0.03
191 0.03
192 0.05
193 0.06
194 0.06
195 0.06
196 0.1
197 0.09
198 0.1
199 0.1
200 0.09
201 0.09
202 0.09
203 0.1
204 0.07
205 0.07
206 0.07
207 0.07
208 0.07
209 0.06
210 0.06
211 0.05
212 0.04
213 0.05
214 0.05
215 0.05
216 0.06
217 0.06
218 0.06
219 0.06
220 0.08
221 0.07
222 0.06
223 0.06
224 0.07
225 0.08
226 0.09
227 0.1
228 0.1
229 0.12
230 0.13
231 0.17
232 0.18
233 0.18
234 0.19
235 0.19
236 0.17
237 0.15
238 0.15
239 0.12
240 0.12
241 0.14
242 0.16
243 0.18
244 0.2
245 0.2
246 0.21
247 0.21
248 0.19
249 0.18
250 0.16
251 0.14
252 0.17
253 0.17
254 0.22
255 0.22
256 0.24
257 0.31
258 0.33
259 0.35
260 0.35
261 0.38
262 0.35
263 0.42
264 0.46
265 0.44
266 0.48
267 0.45
268 0.44
269 0.44
270 0.41
271 0.34
272 0.28
273 0.22
274 0.16
275 0.17
276 0.15
277 0.11
278 0.11
279 0.1
280 0.1
281 0.17
282 0.21
283 0.24
284 0.28
285 0.29
286 0.29
287 0.29
288 0.31
289 0.31
290 0.32
291 0.3
292 0.25
293 0.28
294 0.31
295 0.3
296 0.29
297 0.27
298 0.23
299 0.22
300 0.21
301 0.23
302 0.19
303 0.19
304 0.19
305 0.16
306 0.13
307 0.14
308 0.16