Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5XJZ2

Protein Details
Accession A0A2C5XJZ2   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MLYTRVQTLLQRRRKQQRQQDQQQDQLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MLYTRVQTLLQRRRKQQRQQDQQQDQLLEISAPYDFKLQPVSLPGISQDELSMLRDKAAASRIGVYEVFEPPVYWETATHYLALPSRAGVVSPLAPVHVEGRPAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.87
3 0.87
4 0.88
5 0.89
6 0.92
7 0.93
8 0.88
9 0.85
10 0.79
11 0.68
12 0.57
13 0.46
14 0.35
15 0.24
16 0.17
17 0.11
18 0.06
19 0.06
20 0.06
21 0.08
22 0.08
23 0.08
24 0.11
25 0.11
26 0.11
27 0.13
28 0.15
29 0.12
30 0.12
31 0.12
32 0.12
33 0.12
34 0.12
35 0.09
36 0.08
37 0.08
38 0.09
39 0.1
40 0.08
41 0.08
42 0.08
43 0.08
44 0.09
45 0.11
46 0.11
47 0.09
48 0.11
49 0.11
50 0.12
51 0.12
52 0.12
53 0.11
54 0.11
55 0.11
56 0.1
57 0.09
58 0.1
59 0.12
60 0.11
61 0.1
62 0.09
63 0.14
64 0.19
65 0.19
66 0.18
67 0.17
68 0.18
69 0.2
70 0.21
71 0.15
72 0.11
73 0.12
74 0.11
75 0.11
76 0.1
77 0.11
78 0.11
79 0.12
80 0.11
81 0.1
82 0.1
83 0.12
84 0.14
85 0.13