Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5Y5E5

Protein Details
Accession A0A2C5Y5E5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
5-30SVIPRACHNCRVRKIRCNRENPCSNCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MGPNSVIPRACHNCRVRKIRCNRENPCSNCITSSLVCQPNSASAARVAIPASRFIITAASAPLHTIPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.73
3 0.72
4 0.74
5 0.8
6 0.82
7 0.84
8 0.84
9 0.81
10 0.81
11 0.82
12 0.77
13 0.7
14 0.62
15 0.53
16 0.43
17 0.38
18 0.31
19 0.21
20 0.2
21 0.21
22 0.23
23 0.22
24 0.22
25 0.2
26 0.19
27 0.21
28 0.19
29 0.13
30 0.1
31 0.11
32 0.11
33 0.12
34 0.1
35 0.11
36 0.11
37 0.12
38 0.14
39 0.13
40 0.13
41 0.12
42 0.13
43 0.11
44 0.12
45 0.12
46 0.11
47 0.1
48 0.11