Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YJ59

Protein Details
Accession A0A2C5YJ59   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
271-294SKLSTRSRGLSQRRRNNIRARSEGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027267  AH/BAR_dom_sf  
IPR028245  PIL1/LSP1  
Gene Ontology GO:0110165  C:cellular anatomical entity  
Pfam View protein in Pfam  
PF13805  Pil1  
Amino Acid Sequences MHRTYSMRASRAPTASQLQSPPPPPSSTKSGRIFGKGHFGHAIRRNAGGAFGPDLAKKLSQLVKMEKNVMRSLELVAKERMEVAQQLSIWGEGGDEDVSDVTDKLGVLIYEIGELEDQYVDRYDQYRITMKSIRNIEASVQPSRDRKAKITDQIAQLKYKEPNSPKIVVLEQELVRAEAESLVAEAQLSNITREKVKAAHMYQFDALMEHCEKVAIIAGYGKHLLELIDDTPVTPGETRQAYDGYEASKAIIQDCEDALTNWVSSDAAVASKLSTRSRGLSQRRRNNIRARSEGHDLSTQDAPLNDTSSWVGRDAAAESDEEEEEEDDNRRSVLDSVNGEPRGRTQDAVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.43
4 0.41
5 0.4
6 0.43
7 0.45
8 0.45
9 0.42
10 0.42
11 0.42
12 0.43
13 0.47
14 0.46
15 0.52
16 0.53
17 0.56
18 0.56
19 0.59
20 0.56
21 0.49
22 0.53
23 0.44
24 0.41
25 0.4
26 0.37
27 0.39
28 0.45
29 0.49
30 0.4
31 0.41
32 0.39
33 0.34
34 0.34
35 0.27
36 0.2
37 0.15
38 0.15
39 0.15
40 0.14
41 0.16
42 0.16
43 0.15
44 0.14
45 0.18
46 0.22
47 0.25
48 0.31
49 0.37
50 0.43
51 0.46
52 0.54
53 0.49
54 0.48
55 0.47
56 0.42
57 0.36
58 0.29
59 0.28
60 0.26
61 0.26
62 0.25
63 0.23
64 0.22
65 0.21
66 0.21
67 0.18
68 0.14
69 0.14
70 0.13
71 0.14
72 0.13
73 0.14
74 0.13
75 0.13
76 0.12
77 0.09
78 0.07
79 0.05
80 0.06
81 0.05
82 0.04
83 0.05
84 0.04
85 0.05
86 0.05
87 0.05
88 0.04
89 0.05
90 0.05
91 0.05
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.06
108 0.07
109 0.09
110 0.1
111 0.11
112 0.14
113 0.19
114 0.19
115 0.24
116 0.29
117 0.29
118 0.34
119 0.36
120 0.36
121 0.31
122 0.3
123 0.28
124 0.27
125 0.29
126 0.24
127 0.22
128 0.23
129 0.25
130 0.27
131 0.31
132 0.28
133 0.28
134 0.33
135 0.38
136 0.42
137 0.45
138 0.47
139 0.48
140 0.53
141 0.51
142 0.46
143 0.4
144 0.37
145 0.35
146 0.32
147 0.32
148 0.28
149 0.33
150 0.36
151 0.38
152 0.34
153 0.33
154 0.31
155 0.26
156 0.24
157 0.2
158 0.16
159 0.15
160 0.14
161 0.12
162 0.11
163 0.1
164 0.09
165 0.05
166 0.05
167 0.04
168 0.04
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.04
175 0.05
176 0.06
177 0.07
178 0.08
179 0.09
180 0.1
181 0.11
182 0.12
183 0.15
184 0.2
185 0.21
186 0.26
187 0.26
188 0.28
189 0.26
190 0.25
191 0.21
192 0.15
193 0.13
194 0.11
195 0.11
196 0.09
197 0.08
198 0.08
199 0.08
200 0.08
201 0.1
202 0.06
203 0.06
204 0.08
205 0.08
206 0.09
207 0.1
208 0.09
209 0.07
210 0.07
211 0.07
212 0.06
213 0.07
214 0.06
215 0.07
216 0.07
217 0.07
218 0.08
219 0.08
220 0.08
221 0.07
222 0.07
223 0.1
224 0.11
225 0.12
226 0.13
227 0.13
228 0.13
229 0.14
230 0.15
231 0.12
232 0.12
233 0.11
234 0.1
235 0.11
236 0.11
237 0.1
238 0.11
239 0.1
240 0.11
241 0.11
242 0.12
243 0.1
244 0.11
245 0.11
246 0.11
247 0.1
248 0.08
249 0.09
250 0.07
251 0.07
252 0.07
253 0.06
254 0.05
255 0.06
256 0.06
257 0.06
258 0.09
259 0.13
260 0.14
261 0.16
262 0.18
263 0.21
264 0.28
265 0.37
266 0.45
267 0.53
268 0.62
269 0.69
270 0.78
271 0.83
272 0.85
273 0.85
274 0.83
275 0.81
276 0.78
277 0.73
278 0.67
279 0.66
280 0.59
281 0.52
282 0.47
283 0.39
284 0.35
285 0.32
286 0.27
287 0.22
288 0.2
289 0.2
290 0.16
291 0.18
292 0.15
293 0.14
294 0.16
295 0.16
296 0.17
297 0.16
298 0.15
299 0.13
300 0.14
301 0.14
302 0.14
303 0.12
304 0.12
305 0.12
306 0.13
307 0.13
308 0.12
309 0.11
310 0.1
311 0.1
312 0.12
313 0.14
314 0.13
315 0.13
316 0.13
317 0.13
318 0.13
319 0.15
320 0.17
321 0.21
322 0.24
323 0.27
324 0.35
325 0.37
326 0.36
327 0.35
328 0.35
329 0.36
330 0.34
331 0.31