Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AIR2

Protein Details
Accession G3AIR2   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-22QITPKFRNEKRPRGGLLRGKBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002314  aa-tRNA-synt_IIb  
IPR006195  aa-tRNA-synth_II  
IPR045864  aa-tRNA-synth_II/BPL/LPL  
IPR036621  Anticodon-bd_dom_sf  
Gene Ontology GO:0004812  F:aminoacyl-tRNA ligase activity  
GO:0005524  F:ATP binding  
GO:0006418  P:tRNA aminoacylation for protein translation  
KEGG spaa:SPAPADRAFT_59906  -  
Pfam View protein in Pfam  
PF00587  tRNA-synt_2b  
PROSITE View protein in PROSITE  
PS50862  AA_TRNA_LIGASE_II  
Amino Acid Sequences MYQITPKFRNEKRPRGGLLRGKEFIMKDAYSFDYSEEQAMVTYDNVVGAYTKIFQDLRVDYVKAAADSGEIGGSLSHEWHCFHETGEDTVFSCDSCKHVSNSEKTLSYPQEVTSVDKVSVRYFMTEDKQTLVCAYYPTKRTLEPKFVKQEIPEIDLKFTNQEEILAEFSNPDTLISKSIIRLMDSRLDSRSNFPDFPVPFVSRSLISMITDIPIVLAEDGEVCERCGDGTLSATRAIELGHTFYLGDKYSKPLGFKIDTPNNEGKLTRNDVMMGCYGIGVSRIIATIAEVYRDSIGLKWPSSIAPWQVTVVEAPGIDSDSSEVTEFYQMLNDSEIDYRRDGRASVSMGKKLKESNMVGIPLSIIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.77
3 0.8
4 0.78
5 0.76
6 0.73
7 0.66
8 0.58
9 0.57
10 0.5
11 0.43
12 0.39
13 0.3
14 0.23
15 0.25
16 0.27
17 0.24
18 0.24
19 0.22
20 0.2
21 0.21
22 0.21
23 0.18
24 0.14
25 0.12
26 0.13
27 0.11
28 0.08
29 0.08
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.08
37 0.08
38 0.09
39 0.12
40 0.12
41 0.12
42 0.18
43 0.19
44 0.22
45 0.24
46 0.24
47 0.21
48 0.24
49 0.24
50 0.18
51 0.17
52 0.12
53 0.09
54 0.09
55 0.09
56 0.06
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.07
63 0.08
64 0.09
65 0.1
66 0.13
67 0.16
68 0.16
69 0.16
70 0.19
71 0.19
72 0.2
73 0.2
74 0.18
75 0.16
76 0.17
77 0.16
78 0.12
79 0.11
80 0.09
81 0.11
82 0.14
83 0.16
84 0.16
85 0.23
86 0.31
87 0.35
88 0.39
89 0.4
90 0.37
91 0.36
92 0.41
93 0.36
94 0.31
95 0.27
96 0.23
97 0.23
98 0.23
99 0.25
100 0.22
101 0.21
102 0.19
103 0.2
104 0.2
105 0.17
106 0.19
107 0.16
108 0.14
109 0.14
110 0.17
111 0.19
112 0.21
113 0.2
114 0.2
115 0.2
116 0.19
117 0.18
118 0.15
119 0.12
120 0.12
121 0.14
122 0.18
123 0.2
124 0.23
125 0.24
126 0.26
127 0.32
128 0.35
129 0.42
130 0.41
131 0.47
132 0.51
133 0.52
134 0.5
135 0.45
136 0.46
137 0.37
138 0.36
139 0.32
140 0.26
141 0.25
142 0.23
143 0.23
144 0.18
145 0.16
146 0.13
147 0.09
148 0.09
149 0.08
150 0.09
151 0.1
152 0.08
153 0.08
154 0.07
155 0.07
156 0.07
157 0.07
158 0.06
159 0.06
160 0.06
161 0.08
162 0.09
163 0.09
164 0.09
165 0.13
166 0.13
167 0.12
168 0.13
169 0.13
170 0.18
171 0.18
172 0.19
173 0.18
174 0.19
175 0.19
176 0.21
177 0.24
178 0.22
179 0.21
180 0.2
181 0.25
182 0.23
183 0.25
184 0.26
185 0.23
186 0.2
187 0.21
188 0.21
189 0.15
190 0.15
191 0.14
192 0.11
193 0.09
194 0.09
195 0.08
196 0.08
197 0.07
198 0.06
199 0.05
200 0.04
201 0.04
202 0.04
203 0.03
204 0.03
205 0.03
206 0.04
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.06
214 0.06
215 0.06
216 0.08
217 0.09
218 0.1
219 0.11
220 0.11
221 0.1
222 0.09
223 0.09
224 0.08
225 0.07
226 0.08
227 0.07
228 0.08
229 0.08
230 0.08
231 0.1
232 0.1
233 0.11
234 0.09
235 0.13
236 0.19
237 0.21
238 0.21
239 0.22
240 0.26
241 0.27
242 0.3
243 0.36
244 0.38
245 0.38
246 0.43
247 0.45
248 0.42
249 0.41
250 0.38
251 0.33
252 0.31
253 0.35
254 0.3
255 0.26
256 0.25
257 0.24
258 0.26
259 0.23
260 0.17
261 0.11
262 0.1
263 0.09
264 0.07
265 0.08
266 0.06
267 0.05
268 0.05
269 0.05
270 0.05
271 0.05
272 0.06
273 0.08
274 0.08
275 0.1
276 0.09
277 0.1
278 0.11
279 0.11
280 0.11
281 0.09
282 0.15
283 0.17
284 0.17
285 0.17
286 0.18
287 0.18
288 0.2
289 0.23
290 0.21
291 0.2
292 0.21
293 0.21
294 0.2
295 0.2
296 0.18
297 0.15
298 0.12
299 0.09
300 0.09
301 0.08
302 0.09
303 0.08
304 0.08
305 0.08
306 0.08
307 0.09
308 0.09
309 0.09
310 0.09
311 0.11
312 0.11
313 0.1
314 0.13
315 0.12
316 0.13
317 0.14
318 0.13
319 0.13
320 0.17
321 0.19
322 0.18
323 0.2
324 0.22
325 0.23
326 0.24
327 0.23
328 0.23
329 0.26
330 0.28
331 0.35
332 0.37
333 0.43
334 0.45
335 0.46
336 0.47
337 0.45
338 0.46
339 0.46
340 0.43
341 0.43
342 0.45
343 0.45
344 0.42
345 0.37