Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P4Q5

Protein Details
Accession J3P4Q5    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
78-98GESLRRQRGRKKDNNKGKTHSBasic
NLS Segment(s)
PositionSequence
82-95RRQRGRKKDNNKGK
Subcellular Location(s) mito 13, extr 6, nucl 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MAVSKPKKQSCLHGLSVLPMGVAVGHASVTGGSRWMIWVSGCETSGLGGLTVWGPCKHTIWVELKLTELTELTELTAGESLRRQRGRKKDNNKGKTHSAVPIGRARQSLDTPVSSTRRQSTTKVQCSAVRPAGSQPGDRTARSQSRDGSNDGVTASTTTTSSSSSTTTTTTRSPVAHIHTPAGSRTLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.46
3 0.45
4 0.35
5 0.25
6 0.17
7 0.13
8 0.08
9 0.08
10 0.05
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.05
17 0.05
18 0.06
19 0.06
20 0.06
21 0.08
22 0.08
23 0.08
24 0.07
25 0.09
26 0.11
27 0.12
28 0.12
29 0.12
30 0.11
31 0.11
32 0.11
33 0.1
34 0.07
35 0.05
36 0.05
37 0.06
38 0.07
39 0.08
40 0.08
41 0.1
42 0.11
43 0.12
44 0.13
45 0.14
46 0.19
47 0.21
48 0.26
49 0.26
50 0.25
51 0.25
52 0.24
53 0.23
54 0.18
55 0.13
56 0.08
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.07
64 0.06
65 0.07
66 0.09
67 0.12
68 0.18
69 0.23
70 0.25
71 0.32
72 0.43
73 0.53
74 0.6
75 0.67
76 0.71
77 0.78
78 0.84
79 0.82
80 0.76
81 0.7
82 0.63
83 0.55
84 0.48
85 0.42
86 0.34
87 0.32
88 0.32
89 0.29
90 0.27
91 0.26
92 0.24
93 0.21
94 0.2
95 0.21
96 0.17
97 0.16
98 0.16
99 0.2
100 0.22
101 0.21
102 0.23
103 0.24
104 0.26
105 0.28
106 0.3
107 0.37
108 0.44
109 0.5
110 0.5
111 0.49
112 0.49
113 0.5
114 0.53
115 0.48
116 0.38
117 0.31
118 0.3
119 0.35
120 0.33
121 0.31
122 0.25
123 0.28
124 0.3
125 0.3
126 0.3
127 0.31
128 0.36
129 0.38
130 0.4
131 0.37
132 0.42
133 0.44
134 0.44
135 0.4
136 0.33
137 0.31
138 0.27
139 0.22
140 0.15
141 0.13
142 0.11
143 0.08
144 0.08
145 0.08
146 0.08
147 0.09
148 0.1
149 0.11
150 0.12
151 0.12
152 0.14
153 0.15
154 0.16
155 0.18
156 0.2
157 0.21
158 0.23
159 0.23
160 0.24
161 0.28
162 0.33
163 0.37
164 0.37
165 0.37
166 0.36
167 0.37
168 0.35