Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YGN3

Protein Details
Accession A0A2C5YGN3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
115-138YQLMRDRAHSRRQRRRATSTPGTRHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, mito 4, extr 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR025929  INSIG_fam  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF07281  INSIG  
Amino Acid Sequences MADLDNGPHIVRPIARRPFGLSLDSGTGCDGGCPHEQNSQTPPSPLQQESLLAPPLETLSRPQSILNLTSSTLMGIYSQAAAANPPSRDELVTDTPWGTGAQTPVRRSGIDDATYQLMRDRAHSRRQRRRATSTPGTRAGLGPSALDTASSLALLFVLGCGYGALVGTLHGDEQQEAQLGGYYIRPGLNWRYLTFWGAAGALLGSSLPWLDRVWERALGDEADLYASAKESDLGTDWTLVMRAVGAFVGIVFAIRKLAWASTLQVSATLALVNPLLWWLIDRSKPGLVLSAVVGLAGSMLLLGVCPQMMPAPTRSPMASPMSASPSPSAIVAPTNGSSPEAPPGQGPSWTMLGGLASQETLERGVWIVSVLFCSCICFGNIGRRLAWRRGASGKGRWGWVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.44
4 0.49
5 0.52
6 0.5
7 0.46
8 0.38
9 0.32
10 0.33
11 0.32
12 0.26
13 0.21
14 0.18
15 0.15
16 0.14
17 0.12
18 0.11
19 0.15
20 0.18
21 0.19
22 0.25
23 0.27
24 0.3
25 0.35
26 0.39
27 0.37
28 0.36
29 0.37
30 0.36
31 0.4
32 0.37
33 0.33
34 0.27
35 0.28
36 0.27
37 0.28
38 0.26
39 0.2
40 0.19
41 0.17
42 0.17
43 0.16
44 0.14
45 0.15
46 0.17
47 0.19
48 0.2
49 0.2
50 0.22
51 0.24
52 0.26
53 0.24
54 0.2
55 0.19
56 0.19
57 0.19
58 0.15
59 0.12
60 0.1
61 0.08
62 0.07
63 0.07
64 0.06
65 0.06
66 0.06
67 0.06
68 0.07
69 0.1
70 0.14
71 0.13
72 0.15
73 0.17
74 0.18
75 0.18
76 0.19
77 0.21
78 0.22
79 0.23
80 0.23
81 0.21
82 0.2
83 0.2
84 0.19
85 0.14
86 0.11
87 0.13
88 0.19
89 0.23
90 0.25
91 0.29
92 0.3
93 0.29
94 0.3
95 0.32
96 0.3
97 0.27
98 0.26
99 0.24
100 0.25
101 0.25
102 0.23
103 0.18
104 0.17
105 0.15
106 0.19
107 0.24
108 0.26
109 0.36
110 0.46
111 0.55
112 0.63
113 0.73
114 0.79
115 0.8
116 0.84
117 0.82
118 0.82
119 0.81
120 0.79
121 0.75
122 0.69
123 0.61
124 0.53
125 0.45
126 0.37
127 0.29
128 0.2
129 0.14
130 0.1
131 0.1
132 0.09
133 0.08
134 0.07
135 0.06
136 0.06
137 0.05
138 0.05
139 0.04
140 0.04
141 0.04
142 0.03
143 0.03
144 0.02
145 0.02
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.03
154 0.03
155 0.03
156 0.04
157 0.05
158 0.05
159 0.05
160 0.06
161 0.06
162 0.06
163 0.06
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.05
170 0.06
171 0.06
172 0.06
173 0.08
174 0.11
175 0.16
176 0.17
177 0.17
178 0.2
179 0.2
180 0.22
181 0.2
182 0.16
183 0.11
184 0.1
185 0.1
186 0.06
187 0.05
188 0.04
189 0.03
190 0.03
191 0.02
192 0.02
193 0.02
194 0.02
195 0.03
196 0.03
197 0.05
198 0.06
199 0.09
200 0.11
201 0.14
202 0.14
203 0.14
204 0.15
205 0.13
206 0.12
207 0.1
208 0.08
209 0.06
210 0.06
211 0.05
212 0.04
213 0.04
214 0.04
215 0.04
216 0.05
217 0.05
218 0.05
219 0.06
220 0.07
221 0.07
222 0.08
223 0.08
224 0.07
225 0.07
226 0.07
227 0.06
228 0.04
229 0.04
230 0.04
231 0.03
232 0.03
233 0.03
234 0.03
235 0.03
236 0.03
237 0.03
238 0.03
239 0.03
240 0.04
241 0.04
242 0.05
243 0.05
244 0.06
245 0.07
246 0.08
247 0.1
248 0.11
249 0.12
250 0.11
251 0.11
252 0.11
253 0.1
254 0.1
255 0.07
256 0.05
257 0.05
258 0.05
259 0.05
260 0.04
261 0.04
262 0.04
263 0.04
264 0.05
265 0.07
266 0.11
267 0.13
268 0.15
269 0.17
270 0.18
271 0.19
272 0.18
273 0.19
274 0.15
275 0.14
276 0.12
277 0.11
278 0.1
279 0.09
280 0.08
281 0.05
282 0.05
283 0.04
284 0.03
285 0.02
286 0.02
287 0.02
288 0.02
289 0.03
290 0.03
291 0.03
292 0.03
293 0.03
294 0.05
295 0.07
296 0.09
297 0.12
298 0.16
299 0.18
300 0.2
301 0.2
302 0.2
303 0.24
304 0.27
305 0.24
306 0.22
307 0.23
308 0.28
309 0.28
310 0.28
311 0.24
312 0.2
313 0.19
314 0.18
315 0.16
316 0.1
317 0.11
318 0.1
319 0.12
320 0.11
321 0.12
322 0.12
323 0.14
324 0.14
325 0.13
326 0.17
327 0.17
328 0.16
329 0.16
330 0.21
331 0.2
332 0.21
333 0.21
334 0.19
335 0.19
336 0.19
337 0.18
338 0.13
339 0.12
340 0.11
341 0.1
342 0.08
343 0.06
344 0.06
345 0.06
346 0.07
347 0.08
348 0.07
349 0.07
350 0.08
351 0.08
352 0.08
353 0.08
354 0.09
355 0.08
356 0.1
357 0.09
358 0.1
359 0.1
360 0.12
361 0.13
362 0.13
363 0.13
364 0.14
365 0.16
366 0.25
367 0.32
368 0.32
369 0.33
370 0.4
371 0.46
372 0.49
373 0.56
374 0.48
375 0.48
376 0.52
377 0.59
378 0.57
379 0.59
380 0.62
381 0.58