Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8UQN3

Protein Details
Accession J8UQN3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
32-51KTFHIFKKIKHKRKALYFKNBasic
NLS Segment(s)
PositionSequence
39-45KIKHKRK
Subcellular Location(s) nucl 6.5, mito 5, cyto_nucl 5, E.R. 4, plas 3, extr 3, pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVLNANREFIRYCVILLNAFNFFVFIFKCAPKTFHIFKKIKHKRKALYFKNVFNFGLNKNRLKFRKLLVNVCNINGFFKRIAVLLKNYLNFYYKSKSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.19
5 0.15
6 0.15
7 0.14
8 0.11
9 0.1
10 0.1
11 0.09
12 0.08
13 0.1
14 0.11
15 0.14
16 0.15
17 0.18
18 0.19
19 0.26
20 0.31
21 0.35
22 0.45
23 0.45
24 0.49
25 0.59
26 0.67
27 0.7
28 0.72
29 0.73
30 0.7
31 0.77
32 0.83
33 0.79
34 0.79
35 0.74
36 0.7
37 0.66
38 0.61
39 0.5
40 0.41
41 0.36
42 0.27
43 0.31
44 0.29
45 0.3
46 0.3
47 0.38
48 0.39
49 0.4
50 0.41
51 0.36
52 0.43
53 0.44
54 0.5
55 0.46
56 0.52
57 0.5
58 0.47
59 0.46
60 0.35
61 0.33
62 0.26
63 0.25
64 0.16
65 0.15
66 0.15
67 0.14
68 0.17
69 0.18
70 0.21
71 0.25
72 0.29
73 0.31
74 0.32
75 0.32
76 0.32
77 0.3
78 0.31