Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YE05

Protein Details
Accession A0A2C5YE05    Localization Confidence High Confidence Score 23.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-44SSKAKRGKESKGKEREKEREMBasic
64-90REMDKESKRERERKKERENKVKDKGIVBasic
111-132STDGRVRRGPRRRRDGGPAGRPBasic
NLS Segment(s)
PositionSequence
3-85AKAKEKMKRAWRDLASQGKGMSSKAKRGKESKGKEREKEREMDKESKRERDKERDKERDKEREMDKESKRERERKKERENKVK
114-131GRVRRGPRRRRDGGPAGR
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
Amino Acid Sequences MKAKAKEKMKRAWRDLASQGKGMSSKAKRGKESKGKEREKEREMDKESKRERDKERDKERDKEREMDKESKRERERKKERENKVKDKGIVCFGCRGFGLAGGHLRRHPSQSTDGRVRRGPRRRRDGGPAGRPGSWPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.71
3 0.71
4 0.64
5 0.55
6 0.49
7 0.42
8 0.39
9 0.33
10 0.34
11 0.27
12 0.33
13 0.39
14 0.45
15 0.5
16 0.55
17 0.64
18 0.65
19 0.72
20 0.73
21 0.76
22 0.78
23 0.79
24 0.83
25 0.81
26 0.75
27 0.72
28 0.65
29 0.64
30 0.61
31 0.63
32 0.58
33 0.59
34 0.6
35 0.62
36 0.64
37 0.62
38 0.64
39 0.65
40 0.71
41 0.72
42 0.77
43 0.78
44 0.78
45 0.79
46 0.8
47 0.78
48 0.71
49 0.68
50 0.61
51 0.58
52 0.58
53 0.58
54 0.53
55 0.54
56 0.54
57 0.56
58 0.59
59 0.61
60 0.64
61 0.66
62 0.74
63 0.75
64 0.82
65 0.83
66 0.86
67 0.88
68 0.89
69 0.88
70 0.86
71 0.81
72 0.74
73 0.67
74 0.59
75 0.56
76 0.48
77 0.39
78 0.36
79 0.3
80 0.27
81 0.24
82 0.23
83 0.15
84 0.16
85 0.16
86 0.12
87 0.17
88 0.18
89 0.19
90 0.19
91 0.23
92 0.22
93 0.25
94 0.26
95 0.25
96 0.33
97 0.38
98 0.45
99 0.51
100 0.54
101 0.55
102 0.58
103 0.61
104 0.63
105 0.66
106 0.69
107 0.69
108 0.75
109 0.77
110 0.78
111 0.8
112 0.81
113 0.81
114 0.8
115 0.78
116 0.71
117 0.65