Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7ZGH5

Protein Details
Accession A0A2B7ZGH5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
40-62DMTFACKKCKKCFRKDAREFEDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008913  Znf_CHY  
IPR037274  Znf_CHY_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05495  zf-CHY  
PROSITE View protein in PROSITE  
PS51266  ZF_CHY  
Amino Acid Sequences MCKHVLNAQVSIRSPCCRRWFDCAECHQEQENHELLQSFDMTFACKKCKKCFRKDAREFEDSDEYCPHCDNHFVLDALTPKAALKVEGEDARVDSRMLKDERVRPEEERTIFNVKDAPNRLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.44
4 0.46
5 0.48
6 0.52
7 0.57
8 0.57
9 0.62
10 0.62
11 0.61
12 0.56
13 0.56
14 0.51
15 0.45
16 0.41
17 0.37
18 0.33
19 0.24
20 0.23
21 0.21
22 0.17
23 0.16
24 0.15
25 0.09
26 0.08
27 0.08
28 0.09
29 0.11
30 0.12
31 0.19
32 0.23
33 0.27
34 0.36
35 0.47
36 0.54
37 0.63
38 0.72
39 0.76
40 0.82
41 0.87
42 0.88
43 0.83
44 0.77
45 0.68
46 0.6
47 0.56
48 0.45
49 0.37
50 0.29
51 0.23
52 0.21
53 0.2
54 0.18
55 0.11
56 0.12
57 0.11
58 0.12
59 0.13
60 0.12
61 0.12
62 0.13
63 0.14
64 0.13
65 0.12
66 0.1
67 0.09
68 0.1
69 0.1
70 0.09
71 0.08
72 0.09
73 0.13
74 0.15
75 0.16
76 0.14
77 0.16
78 0.16
79 0.16
80 0.14
81 0.12
82 0.13
83 0.19
84 0.2
85 0.24
86 0.3
87 0.36
88 0.45
89 0.48
90 0.5
91 0.46
92 0.52
93 0.55
94 0.51
95 0.47
96 0.43
97 0.45
98 0.41
99 0.39
100 0.38
101 0.32
102 0.38