Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8U8V3

Protein Details
Accession J8U8V3    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
55-79ALTTIQKAKRKRPKVRCYGCKELGYHydrophilic
NLS Segment(s)
PositionSequence
62-68AKRKRPK
Subcellular Location(s) mito 17, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences KALKAKIISKPHKGTPGDTNVLAFKKPVTCFKCGQLSHIVAACKIRTDNPETPLALTTIQKAKRKRPKVRCYGCKELGYIRPACPKKNKILLPNSIPLFGRLSTGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.58
3 0.58
4 0.52
5 0.46
6 0.41
7 0.36
8 0.36
9 0.32
10 0.23
11 0.18
12 0.2
13 0.22
14 0.3
15 0.29
16 0.32
17 0.34
18 0.39
19 0.45
20 0.4
21 0.41
22 0.38
23 0.35
24 0.33
25 0.33
26 0.29
27 0.21
28 0.22
29 0.19
30 0.13
31 0.13
32 0.13
33 0.13
34 0.2
35 0.23
36 0.24
37 0.27
38 0.26
39 0.26
40 0.24
41 0.22
42 0.16
43 0.12
44 0.12
45 0.16
46 0.21
47 0.26
48 0.31
49 0.4
50 0.5
51 0.6
52 0.69
53 0.74
54 0.79
55 0.84
56 0.9
57 0.9
58 0.89
59 0.87
60 0.83
61 0.73
62 0.65
63 0.59
64 0.54
65 0.48
66 0.42
67 0.36
68 0.4
69 0.41
70 0.46
71 0.5
72 0.5
73 0.54
74 0.62
75 0.65
76 0.65
77 0.7
78 0.72
79 0.68
80 0.7
81 0.62
82 0.55
83 0.49
84 0.42
85 0.36
86 0.28