Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3P4Q0

Protein Details
Accession J3P4Q0    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-35ASSSSYRRKGMRPTRPRQRSRLPGGSRHydrophilic
NLS Segment(s)
PositionSequence
15-40RRKGMRPTRPRQRSRLPGGSRKAGRG
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
Amino Acid Sequences MAFSSLIQASSSSYRRKGMRPTRPRQRSRLPGGSRKAGRGGFRAYSILTFGRPSLTLAAYAKTTFERRRQVHKCREGRGRAKQDMPLGYVHKKGHVGHPSTWLPLCQVQMRMRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.43
4 0.51
5 0.56
6 0.62
7 0.68
8 0.75
9 0.81
10 0.87
11 0.88
12 0.86
13 0.86
14 0.84
15 0.83
16 0.82
17 0.79
18 0.77
19 0.75
20 0.75
21 0.67
22 0.59
23 0.55
24 0.48
25 0.42
26 0.37
27 0.35
28 0.28
29 0.26
30 0.25
31 0.2
32 0.17
33 0.16
34 0.13
35 0.1
36 0.09
37 0.08
38 0.08
39 0.08
40 0.09
41 0.08
42 0.08
43 0.09
44 0.09
45 0.1
46 0.09
47 0.09
48 0.09
49 0.09
50 0.14
51 0.17
52 0.23
53 0.32
54 0.35
55 0.45
56 0.54
57 0.62
58 0.68
59 0.74
60 0.75
61 0.74
62 0.79
63 0.78
64 0.78
65 0.78
66 0.76
67 0.72
68 0.68
69 0.64
70 0.6
71 0.53
72 0.45
73 0.38
74 0.34
75 0.32
76 0.34
77 0.31
78 0.29
79 0.31
80 0.31
81 0.36
82 0.4
83 0.41
84 0.38
85 0.45
86 0.44
87 0.44
88 0.43
89 0.35
90 0.3
91 0.28
92 0.3
93 0.26
94 0.31