Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7ZCW2

Protein Details
Accession A0A2B7ZCW2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-31TKAPAATTGKKQKKKWSKGKVKDKANHAVIHydrophilic
NLS Segment(s)
PositionSequence
10-25GKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 11, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MTKAPAATTGKKQKKKWSKGKVKDKANHAVILDKATSEKLYKDVQSYRLITVATLVDRLKINGSLARQALSDLEEKGQIKKVVGHSKMNIYTRAVTAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.86
4 0.86
5 0.87
6 0.89
7 0.94
8 0.93
9 0.92
10 0.88
11 0.84
12 0.82
13 0.74
14 0.66
15 0.55
16 0.48
17 0.39
18 0.34
19 0.26
20 0.17
21 0.14
22 0.12
23 0.13
24 0.1
25 0.1
26 0.11
27 0.14
28 0.15
29 0.18
30 0.2
31 0.23
32 0.26
33 0.27
34 0.24
35 0.23
36 0.22
37 0.17
38 0.16
39 0.13
40 0.08
41 0.09
42 0.08
43 0.09
44 0.09
45 0.1
46 0.1
47 0.09
48 0.1
49 0.11
50 0.12
51 0.15
52 0.15
53 0.15
54 0.14
55 0.14
56 0.13
57 0.13
58 0.13
59 0.1
60 0.11
61 0.14
62 0.15
63 0.17
64 0.22
65 0.21
66 0.21
67 0.25
68 0.33
69 0.39
70 0.42
71 0.46
72 0.44
73 0.51
74 0.56
75 0.54
76 0.48
77 0.42
78 0.4
79 0.35