Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7ZM62

Protein Details
Accession A0A2B7ZM62   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-33NRSSSRASSHRRSHSRDRHSTTSHydrophilic
NLS Segment(s)
PositionSequence
78-96RRAKPRSGFIARTVRKIRR
Subcellular Location(s) mito 9, plas 8, nucl 2, pero 2, golg 2, cyto 1, extr 1, E.R. 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDWLYPFSGLNRSSSRASSHRRSHSRDRHSTTSSRHSHSNGKSHSSPSLFNLGGHANRSTASASSLFSIGSAASSSSRRAKPRSGFIARTVRKIRRLLRHIMRYARSHPLKVFFMVIMPLITGGVLQKLLAVVGVRLPPSLGGGHGAGFKGGHSGGGLSGILGGGGGGGGGLGESVGGLVSLAKMFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.37
4 0.44
5 0.49
6 0.55
7 0.62
8 0.68
9 0.74
10 0.79
11 0.82
12 0.84
13 0.84
14 0.83
15 0.79
16 0.76
17 0.75
18 0.7
19 0.7
20 0.65
21 0.58
22 0.55
23 0.51
24 0.55
25 0.55
26 0.57
27 0.51
28 0.52
29 0.51
30 0.49
31 0.5
32 0.43
33 0.38
34 0.31
35 0.34
36 0.27
37 0.24
38 0.24
39 0.22
40 0.21
41 0.21
42 0.19
43 0.13
44 0.13
45 0.14
46 0.13
47 0.1
48 0.11
49 0.1
50 0.1
51 0.1
52 0.1
53 0.09
54 0.08
55 0.08
56 0.06
57 0.05
58 0.05
59 0.04
60 0.06
61 0.07
62 0.09
63 0.16
64 0.2
65 0.24
66 0.28
67 0.35
68 0.38
69 0.44
70 0.5
71 0.49
72 0.47
73 0.49
74 0.56
75 0.5
76 0.53
77 0.52
78 0.47
79 0.47
80 0.51
81 0.52
82 0.51
83 0.54
84 0.56
85 0.58
86 0.62
87 0.61
88 0.6
89 0.57
90 0.51
91 0.5
92 0.5
93 0.44
94 0.38
95 0.35
96 0.34
97 0.31
98 0.29
99 0.26
100 0.17
101 0.15
102 0.13
103 0.12
104 0.08
105 0.06
106 0.05
107 0.04
108 0.04
109 0.04
110 0.03
111 0.04
112 0.04
113 0.03
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.06
121 0.08
122 0.08
123 0.08
124 0.08
125 0.08
126 0.09
127 0.09
128 0.07
129 0.08
130 0.08
131 0.09
132 0.1
133 0.1
134 0.09
135 0.08
136 0.08
137 0.08
138 0.08
139 0.07
140 0.06
141 0.07
142 0.06
143 0.08
144 0.07
145 0.05
146 0.06
147 0.05
148 0.05
149 0.04
150 0.04
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.03
167 0.04