Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7ZKT4

Protein Details
Accession A0A2B7ZKT4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
94-119IRNLKYLIIKPHRKRPTKRPTPAEFDHydrophilic
NLS Segment(s)
PositionSequence
103-112KPHRKRPTKR
Subcellular Location(s) nucl 16.5, cyto_nucl 12.333, mito_nucl 11.166, cyto 6
Family & Domain DBs
Amino Acid Sequences MAGYMRPSIKMLAIDCIYPNFDFNLTAVLKTDEYLPVFTLPLTSASASADLTTPSLNELNRELPAESKQLASIDDSEYPEEHTESTQAAGEKEIRNLKYLIIKPHRKRPTKRPTPAEFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.21
4 0.21
5 0.18
6 0.18
7 0.13
8 0.13
9 0.12
10 0.11
11 0.15
12 0.13
13 0.13
14 0.14
15 0.14
16 0.14
17 0.13
18 0.15
19 0.11
20 0.12
21 0.13
22 0.12
23 0.11
24 0.11
25 0.11
26 0.1
27 0.08
28 0.08
29 0.09
30 0.08
31 0.07
32 0.08
33 0.08
34 0.08
35 0.08
36 0.06
37 0.06
38 0.06
39 0.06
40 0.05
41 0.06
42 0.08
43 0.07
44 0.08
45 0.09
46 0.1
47 0.11
48 0.12
49 0.1
50 0.1
51 0.12
52 0.13
53 0.12
54 0.11
55 0.11
56 0.11
57 0.11
58 0.11
59 0.1
60 0.1
61 0.11
62 0.12
63 0.12
64 0.12
65 0.13
66 0.13
67 0.12
68 0.11
69 0.09
70 0.09
71 0.09
72 0.09
73 0.1
74 0.1
75 0.1
76 0.11
77 0.15
78 0.16
79 0.21
80 0.27
81 0.26
82 0.27
83 0.27
84 0.28
85 0.33
86 0.36
87 0.41
88 0.44
89 0.54
90 0.59
91 0.7
92 0.78
93 0.79
94 0.83
95 0.84
96 0.85
97 0.86
98 0.89
99 0.89