Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7Z4N5

Protein Details
Accession A0A2B7Z4N5   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MEPCRVTISMRSRRRRRGGGGREGMHydrophilic
NLS Segment(s)
PositionSequence
12-20SRRRRRGGG
Subcellular Location(s) mito_nucl 11.666, nucl 11.5, mito 11.5, cyto_nucl 8.333, cyto_mito 8.333
Family & Domain DBs
Amino Acid Sequences MEPCRVTISMRSRRRRRGGGGREGMVLAVLVRPQRYGDGNGNGNGNGIDSGDSSGSSSGGSGGSGIGGGIGATANNGRKKVVDSDGGHWRAKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.83
4 0.83
5 0.83
6 0.83
7 0.79
8 0.7
9 0.62
10 0.54
11 0.44
12 0.33
13 0.23
14 0.12
15 0.07
16 0.07
17 0.07
18 0.07
19 0.08
20 0.08
21 0.1
22 0.12
23 0.15
24 0.18
25 0.21
26 0.23
27 0.24
28 0.24
29 0.22
30 0.2
31 0.16
32 0.12
33 0.07
34 0.05
35 0.04
36 0.04
37 0.05
38 0.04
39 0.05
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.06
61 0.11
62 0.15
63 0.16
64 0.16
65 0.18
66 0.21
67 0.26
68 0.28
69 0.32
70 0.32
71 0.37
72 0.47
73 0.5