Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7Z952

Protein Details
Accession A0A2B7Z952    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
113-151ESKGGEKPKPKPKDPKPKPKPKPKPKPKPKGKTVGQKILBasic
NLS Segment(s)
PositionSequence
115-144KGGEKPKPKPKDPKPKPKPKPKPKPKPKGK
Subcellular Location(s) extr 20, mito 3, plas 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000064  NLP_P60_dom  
IPR038765  Papain-like_cys_pep_sf  
Pfam View protein in Pfam  
PF00877  NLPC_P60  
PROSITE View protein in PROSITE  
PS51935  NLPC_P60  
Amino Acid Sequences MRFSTISLALLLCSVVSATPAGEIFERKVGSSCKTMDGVGKCMARSKCAGVYYDGACGKNAGETRCCVQVKCKVGGKSGLCQNTKRSKCKGGKFHVGNSNTCPAGKDVQCCIESKGGEKPKPKPKDPKPKPKPKPKPKPKPKGKTVGQKILDVAMKTKGTRYVWGGGSCKGPTGGGYDCSGLVAYAVCKVTKRSLFKEGLRVTYSMYCASSSRLGKFKKIPFSKRRAGDAVFFGSSCSCKNQNISHMGLMINSGDRMLHAPNPRTVVKEGKVSAQGSLKACPYVIRFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.04
3 0.05
4 0.05
5 0.05
6 0.06
7 0.07
8 0.08
9 0.09
10 0.11
11 0.13
12 0.17
13 0.17
14 0.17
15 0.21
16 0.23
17 0.25
18 0.29
19 0.28
20 0.27
21 0.28
22 0.28
23 0.31
24 0.31
25 0.31
26 0.32
27 0.32
28 0.28
29 0.35
30 0.34
31 0.3
32 0.3
33 0.3
34 0.29
35 0.3
36 0.31
37 0.26
38 0.3
39 0.28
40 0.31
41 0.3
42 0.25
43 0.23
44 0.22
45 0.19
46 0.19
47 0.22
48 0.19
49 0.18
50 0.2
51 0.22
52 0.3
53 0.31
54 0.27
55 0.3
56 0.35
57 0.38
58 0.42
59 0.46
60 0.41
61 0.43
62 0.49
63 0.45
64 0.44
65 0.46
66 0.47
67 0.43
68 0.43
69 0.49
70 0.52
71 0.57
72 0.57
73 0.56
74 0.59
75 0.65
76 0.72
77 0.73
78 0.71
79 0.74
80 0.71
81 0.72
82 0.7
83 0.65
84 0.57
85 0.5
86 0.46
87 0.36
88 0.32
89 0.25
90 0.19
91 0.22
92 0.23
93 0.22
94 0.21
95 0.25
96 0.25
97 0.25
98 0.26
99 0.23
100 0.21
101 0.2
102 0.26
103 0.29
104 0.33
105 0.38
106 0.45
107 0.51
108 0.58
109 0.64
110 0.66
111 0.7
112 0.76
113 0.81
114 0.84
115 0.85
116 0.89
117 0.92
118 0.93
119 0.93
120 0.93
121 0.94
122 0.94
123 0.95
124 0.94
125 0.96
126 0.95
127 0.94
128 0.9
129 0.89
130 0.85
131 0.84
132 0.8
133 0.78
134 0.69
135 0.6
136 0.52
137 0.44
138 0.38
139 0.28
140 0.21
141 0.15
142 0.14
143 0.14
144 0.15
145 0.16
146 0.16
147 0.18
148 0.19
149 0.21
150 0.22
151 0.25
152 0.26
153 0.23
154 0.24
155 0.22
156 0.2
157 0.15
158 0.13
159 0.1
160 0.11
161 0.11
162 0.1
163 0.11
164 0.11
165 0.11
166 0.11
167 0.1
168 0.07
169 0.06
170 0.05
171 0.04
172 0.06
173 0.07
174 0.07
175 0.08
176 0.1
177 0.17
178 0.23
179 0.28
180 0.3
181 0.37
182 0.43
183 0.45
184 0.52
185 0.49
186 0.47
187 0.43
188 0.39
189 0.33
190 0.3
191 0.29
192 0.2
193 0.18
194 0.15
195 0.14
196 0.16
197 0.2
198 0.2
199 0.23
200 0.29
201 0.3
202 0.36
203 0.44
204 0.48
205 0.52
206 0.59
207 0.66
208 0.68
209 0.75
210 0.77
211 0.74
212 0.73
213 0.67
214 0.6
215 0.54
216 0.48
217 0.44
218 0.35
219 0.3
220 0.25
221 0.21
222 0.2
223 0.17
224 0.18
225 0.17
226 0.19
227 0.25
228 0.29
229 0.35
230 0.39
231 0.41
232 0.37
233 0.36
234 0.33
235 0.28
236 0.24
237 0.17
238 0.13
239 0.1
240 0.08
241 0.07
242 0.07
243 0.09
244 0.11
245 0.16
246 0.23
247 0.27
248 0.31
249 0.36
250 0.37
251 0.39
252 0.4
253 0.42
254 0.38
255 0.42
256 0.4
257 0.4
258 0.45
259 0.41
260 0.42
261 0.39
262 0.41
263 0.35
264 0.37
265 0.33
266 0.28
267 0.28
268 0.28