Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3NKG5

Protein Details
Accession J3NKG5    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-39VGFRPNKATQKGRKGRKQKALAPSAHydrophilic
NLS Segment(s)
PositionSequence
22-33ATQKGRKGRKQK
Subcellular Location(s) mito 16, extr 7, nucl 2
Family & Domain DBs
Amino Acid Sequences MDRRQSTADIVMGLVGFRPNKATQKGRKGRKQKALAPSAALESLQQGSVNGDSGRAPAARVITAYQTGKTAPSGARYQLQPPAGCAGANLWQRAVFCHRKGAHSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.09
5 0.13
6 0.16
7 0.23
8 0.3
9 0.38
10 0.45
11 0.56
12 0.65
13 0.72
14 0.78
15 0.82
16 0.85
17 0.86
18 0.85
19 0.81
20 0.81
21 0.77
22 0.68
23 0.59
24 0.5
25 0.41
26 0.32
27 0.25
28 0.15
29 0.1
30 0.09
31 0.08
32 0.07
33 0.05
34 0.06
35 0.06
36 0.07
37 0.06
38 0.06
39 0.06
40 0.06
41 0.07
42 0.06
43 0.06
44 0.06
45 0.07
46 0.07
47 0.08
48 0.08
49 0.08
50 0.12
51 0.12
52 0.11
53 0.11
54 0.11
55 0.12
56 0.11
57 0.13
58 0.1
59 0.14
60 0.15
61 0.17
62 0.21
63 0.22
64 0.24
65 0.27
66 0.3
67 0.26
68 0.26
69 0.27
70 0.23
71 0.21
72 0.19
73 0.15
74 0.19
75 0.22
76 0.21
77 0.19
78 0.2
79 0.2
80 0.24
81 0.3
82 0.3
83 0.29
84 0.38
85 0.4